StarFunc result for job id Q15013

User Input

>input (274 residues)
MAAPEAEVLSSAAVPDLEWYEKSEETHASQIELLETSSTQEPLNASEAFCPRDCMVPVVF
PGPVSQEGCCQFTCELLKHIMYQRQQLPLPYEQLKHFYRKPSPQAEEMLKKKPRATTEVS
SRKCQQALAELESVLSHLEDFFARTLVPRVLILLGGNALSPKEFYELDLSLLAPYSVDQS
LSTAACLRRLFRAIFMADAFSELQAPPLMGTVVMAQGHRNCGEDWFRPKLNYRVPSRGHK
LTVTLSCGRPSIRTTAWEDYIWFQAPVTFKGFRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15013	1.000	1.000	1.143E-54	274	1.000	1.000	Q15013.pdb.gz	MD2BP_HUMAN MAD2L1-binding protein OS=Homo sapiens OX=9606 GN=MAD2L1BP PE=1 SV=1
2	AFDB:Q9DCX1	0.773	0.767	8.290E-43	276	0.774	0.768	Q9DCX1.pdb.gz	MD2BP_MOUSE MAD2L1-binding protein OS=Mus musculus OX=10090 GN=Mad2l1bp PE=1 SV=2
3	PDB:6f0xP	0.693	0.973	7.522E-34	194	0.701	0.990	6f0xP.pdb.gz	Mechanism for remodelling of the cell cycle checkpoint protein MAD2 by the ATPase TRIP13.
4	PDB:4trkA	0.255	0.284	1.347E-1	242	0.062	0.070	4trkA.pdb.gz
5	AFDB:A0A1D8PJR4	0.139	0.070	3.761E-1	669	0.047	0.019	A0A1D8PJR4.pdb.gz	A0A1D8PJR4_CANAL HDA1 complex subunit 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C303670WA PE=4 SV=1
6	PDB:6b3rA	0.107	0.025	4.545E-1	1502	0.077	0.014	6b3rA.pdb.gz	Structure-based membrane dome mechanism for Piezo mechanosensitivity.
7	PDB:5nikD	0.142	0.118	5.133E-1	340	0.095	0.076	5nikD.pdb.gz
8	AFDB:P93527	0.117	0.042	5.757E-1	1178	0.135	0.031	P93527.pdb.gz	PHYB_SORBI Phytochrome B OS=Sorghum bicolor OX=4558 GN=PHYB PE=1 SV=3
9	AFDB:A0A0G2K2I0	0.094	0.044	6.118E-1	740	0.124	0.046	A0A0G2K2I0.pdb.gz	A0A0G2K2I0_RAT SUZ12 polycomb repressive complex 2 subunit OS=Rattus norvegicus OX=10116 GN=Suz12 PE=1 SV=2
10	AFDB:Q96S38	0.112	0.041	6.118E-1	1066	0.120	0.031	Q96S38.pdb.gz	KS6C1_HUMAN Ribosomal protein S6 kinase delta-1 OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=2
11	PDB:7wltA	0.103	0.025	6.958E-1	1353	0.055	0.011	7wltA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
12	AFDB:Q3SZ22	0.118	0.117	7.343E-1	277	0.106	0.105	Q3SZ22.pdb.gz	RM46_BOVIN Large ribosomal subunit protein mL46 OS=Bos taurus OX=9913 GN=MRPL46 PE=2 SV=1
13	PDB:5z10A	0.095	0.025	7.394E-1	1304	0.084	0.018	5z10A.pdb.gz
14	PDB:2v64A	0.326	0.412	7.858E-1	210	0.102	0.133	2v64A.pdb.gz	The MAD2 Conformational Dimer: Structure and Implications for the Spindle Assembly Checkpoint
15	AFDB:O76064	0.143	0.090	8.293E-1	485	0.088	0.049	O76064.pdb.gz	RNF8_HUMAN E3 ubiquitin-protein ligase RNF8 OS=Homo sapiens OX=9606 GN=RNF8 PE=1 SV=1
16	PDB:7wluA	0.103	0.025	8.875E-1	1498	0.077	0.014	7wluA.pdb.gz	Structure deformation and curvature sensing of PIEZO1 in lipid membranes.
17	AFDB:Q8BLK9	0.118	0.048	1.058	1056	0.128	0.033	Q8BLK9.pdb.gz	KS6C1_MOUSE Ribosomal protein S6 kinase delta-1 OS=Mus musculus OX=10090 GN=Rps6kc1 PE=1 SV=2
18	AFDB:Q96MK2	0.156	0.056	1.058	946	0.073	0.021	Q96MK2.pdb.gz	RIPR3_HUMAN RIPOR family member 3 OS=Homo sapiens OX=9606 GN=RIPOR3 PE=1 SV=4
19	PDB:4aezH	0.319	0.450	1.132	185	0.080	0.119	4aezH.pdb.gz
20	PDB:4yk8A	0.232	0.354	1.132	162	0.080	0.136	4yk8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15013	0.0	566	274	1.000	1.000	MD2BP_HUMAN MAD2L1-binding protein OS=Homo sapiens OX=9606 GN=MAD2L1BP PE=1 SV=1
2	Q9DCX1	1.19e-151	426	276	0.766	0.761	MD2BP_MOUSE MAD2L1-binding protein OS=Mus musculus OX=10090 GN=Mad2l1bp PE=1 SV=2
3	Q9ZTZ7	0.010	39.7	1193	0.117	0.027	KEA1_ARATH K(+) efflux antiporter 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA1 PE=1 SV=2
4	Q5Q0J3	0.25	34.7	265	0.190	0.196	Q5Q0J3_ARATH Non-structural protein OS=Arabidopsis thaliana OX=3702 GN=At1g03180 PE=1 SV=1
5	P13199	4.4	31.2	417	0.062	0.041	ICP27_SHV21 mRNA export factor ICP27 homolog OS=Saimiriine herpesvirus 2 (strain 11) OX=10383 GN=EJRF1 PE=1 SV=2
6	Q8WN95	7.8	30.8	2664	0.080	0.008	ITPR3_BOVIN Inositol 1,4,5-trisphosphate receptor type 3 OS=Bos taurus OX=9913 GN=ITPR3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06581 p31comet	1.9e-170	576.4	Mad1 and Cdc20-bound-Mad2 binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003833293.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003804389.1	0.964	Pachytene checkpoint protein 2 homolog
2	9597.XP_003812890.1	0.944	Cell division cycle 20
3	9597.XP_003816473.1	0.940	MAD2 mitotic arrest deficient-like 1 (yeast)
4	9597.XP_008968188.1	0.781	Inositol polyphosphate 5-phosphatase K isoform X1
5	9597.XP_003823511.1	0.690	Centromere protein U
6	9597.XP_008970943.1	0.664	Fizzy/cell division cycle 20 related 1
7	9597.XP_003813751.1	0.653	Serine/threonine-protein kinase PLK1
8	9597.XP_008950209.1	0.629	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta isoform X1
9	9597.XP_003806837.1	0.615	Centromere protein H
10	9597.XP_003819782.1	0.595	Mitotic spindle assembly checkpoint protein MAD1 isoform X1
11	9597.XP_008954993.1	0.580	Transcription factor 24
12	9597.XP_003827440.1	0.571	Polo like kinase 2
13	9597.XP_008950975.1	0.557	Cell division cycle protein 20 homolog B isoform X1
14	9597.XP_008961432.1	0.555	Synaptonemal complex protein 2
15	9597.XP_003810452.2	0.550	Centromere protein I isoform X1
16	9597.XP_003828438.1	0.547	Centrosomal protein 126
17	9597.XP_003812853.1	0.530	Serine/threonine-protein kinase PLK3
18	9597.XP_008950529.1	0.525	Inositol polyphosphate-5-phosphatase J
19	9597.XP_003805707.1	0.521	AP-4 complex subunit beta-1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0033045	0.988	regulation of sister chromatid segregation
GO:1901990	0.978	regulation of mitotic cell cycle phase transition
GO:0048518	0.975	positive regulation of biological process
GO:0048523	0.973	negative regulation of cellular process
GO:0048522	0.972	positive regulation of cellular process
GO:0051783	0.943	regulation of nuclear division
GO:1905818	0.943	regulation of chromosome separation
GO:0030071	0.943	regulation of mitotic metaphase/anaphase transition
GO:0090068	0.934	positive regulation of cell cycle process
GO:0033047	0.934	regulation of mitotic sister chromatid segregation
GO:0010965	0.932	regulation of mitotic sister chromatid separation
GO:0007088	0.926	regulation of mitotic nuclear division
GO:1902531	0.904	regulation of intracellular signal transduction
GO:1901976	0.850	regulation of cell cycle checkpoint
GO:0010638	0.796	positive regulation of organelle organization
GO:0010948	0.795	negative regulation of cell cycle process
GO:2001252	0.785	positive regulation of chromosome organization
GO:1905820	0.779	positive regulation of chromosome separation
GO:0009987	0.718	cellular process
GO:1902532	0.714	negative regulation of intracellular signal transduction
GO:0045931	0.709	positive regulation of mitotic cell cycle
GO:0051785	0.709	positive regulation of nuclear division
GO:0051984	0.707	positive regulation of chromosome segregation
GO:0007096	0.696	regulation of exit from mitosis
GO:1901989	0.695	positive regulation of cell cycle phase transition
GO:1901992	0.658	positive regulation of mitotic cell cycle phase transition
GO:0045840	0.494	positive regulation of mitotic nuclear division
GO:0008152	0.330	metabolic process
GO:0071704	0.302	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0031090	0.999	organelle membrane
GO:0005635	0.999	nuclear envelope
GO:0005730	0.992	nucleolus
GO:0031965	0.990	nuclear membrane
GO:0005829	0.876	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]