StarFunc result for job id Q15014

User Input

>input (288 residues)
MSSRKQGSQPRGQQSAEEENFKKPTRSNMQRSKMRGASSGKKTAGPQQKNLEPALPGRWG
GRSAENPPSGSVRKTRKNKQKTPGNGDGGSTSEAPQPPRKKRARADPTVESEEAFKNRME
VKVKIPEELKPWLVEDWDLVTRQKQLFQLPAKKNVDAILEEYANCKKSQGNVDNKEYAVN
EVVAGIKEYFNVMLGTQLLYKFERPQYAEILLAHPDAPMSQVYGAPHLLRLFVRIGAMLA
YTPLDEKSLALLLGYLHDFLKYLAKNSASLFTASDYKVASAEYHRKAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15014	0.999	0.999	1.308E-38	288	1.000	1.000	Q15014.pdb.gz	MO4L2_HUMAN Mortality factor 4-like protein 2 OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
2	AFDB:B3KTM8	0.634	0.530	2.157E-30	348	0.712	0.589	B3KTM8.pdb.gz	B3KTM8_HUMAN Mortality factor 4 like 1 OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
3	AFDB:P60762	0.613	0.490	6.856E-30	362	0.708	0.564	P60762.pdb.gz	MO4L1_MOUSE Mortality factor 4-like protein 1 OS=Mus musculus OX=10090 GN=Morf4l1 PE=1 SV=2
4	AFDB:O13953	0.571	0.491	8.040E-14	337	0.295	0.252	O13953.pdb.gz	EAF3_SCHPO Chromatin modification-related protein eaf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp13 PE=1 SV=1
5	AFDB:Q12432	0.578	0.419	1.864E-13	401	0.267	0.192	Q12432.pdb.gz	EAF3_YEAST Chromatin modification-related protein EAF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EAF3 PE=1 SV=1
6	AFDB:P10037	0.112	0.111	4.160E-1	291	0.139	0.137	P10037.pdb.gz	PIT1_RAT Pituitary-specific positive transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou1f1 PE=1 SV=3
7	AFDB:B7ZNG0	0.101	0.028	8.238E-1	1348	0.174	0.037	B7ZNG0.pdb.gz	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
8	AFDB:A0A0K3AR81	0.119	0.066	9.645E-1	696	0.142	0.059	A0A0K3AR81.pdb.gz	A0A0K3AR81_CAEEL Chromo domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=uad-2 PE=1 SV=1
9	AFDB:Q8IYA6	0.091	0.043	1.254	745	0.160	0.062	Q8IYA6.pdb.gz	CKP2L_HUMAN Cytoskeleton-associated protein 2-like OS=Homo sapiens OX=9606 GN=CKAP2L PE=1 SV=4
10	AFDB:E9AFP0	0.081	0.045	1.548	594	0.160	0.077	E9AFP0.pdb.gz	E9AFP0_LEIMA Polyadenylate-binding protein OS=Leishmania major OX=5664 GN=PABP2 PE=3 SV=1
11	PDB:3k33A	0.090	0.167	1.742	124	0.059	0.137	3k33A.pdb.gz
12	PDB:6tnnI	0.162	0.283	1.836	134	0.066	0.142	6tnnI.pdb.gz	Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
13	PDB:1f3bA	0.170	0.206	3.105	222	0.083	0.108	1f3bA.pdb.gz	Residue R216 and catalytic efficiency of a murine class alpha glutathione S-transferase toward benzo[a]pyrene 7(R),8(S)-diol 9(S), 10(R)-epoxide.
14	PDB:3emlA	0.122	0.086	3.449	448	0.038	0.025	3emlA.pdb.gz	The 2.6 Angstrom Crystal Structure of a Human A2A Adenosine Receptor Bound to an Antagonist.
15	PDB:6p25A	0.140	0.074	3.449	731	0.108	0.042	6p25A.pdb.gz	Structure of the eukaryotic protein O-mannosyltransferase Pmt1-Pmt2 complex.
16	PDB:7qe7O	0.107	0.047	3.831	707	0.056	0.023	7qe7O.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
17	PDB:1cnt1	0.092	0.155	4.038	150	0.066	0.127	1cnt1.pdb.gz
18	PDB:2wzvB	0.094	0.110	4.038	223	0.083	0.108	2wzvB.pdb.gz	Biological and Structural Characterization of the Mycobacterium Smegmatis Nitroreductase Nfnb, and its Role in Benzothiazinone Resistance
19	PDB:7rkfA	0.131	0.115	4.486	350	0.073	0.060	7rkfA.pdb.gz	Atypical structural snapshots of human cytomegalovirus GPCR interactions with host G proteins
20	PDB:1u2mC	0.101	0.161	4.728	143	0.052	0.105	1u2mC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15014	0.0	594	288	1.000	1.000	MO4L2_HUMAN Mortality factor 4-like protein 2 OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
2	Q6QI89	0.0	570	288	0.955	0.955	MO4L2_RAT Mortality factor 4-like protein 2 OS=Rattus norvegicus OX=10116 GN=Morf4l2 PE=2 SV=1
3	B3KTM8	2.78e-147	418	348	0.719	0.595	B3KTM8_HUMAN Mortality factor 4 like 1 OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
4	Q9UBU8	5.57e-147	418	362	0.719	0.572	MO4L1_HUMAN Mortality factor 4-like protein 1 OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=2
5	P60762	5.63e-147	418	362	0.719	0.572	MO4L1_MOUSE Mortality factor 4-like protein 1 OS=Mus musculus OX=10090 GN=Morf4l1 PE=1 SV=2
6	Q5JXX2	8.42e-128	362	177	0.615	1.000	Q5JXX2_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
7	Q5JXX1	4.84e-112	322	158	0.549	1.000	Q5JXX1_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
8	H0YMJ0	7.53e-84	253	245	0.444	0.522	H0YMJ0_HUMAN Mortality factor 4 like 1 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
9	Q9Y0I1	7.69e-62	203	424	0.333	0.226	EAF3_DROME NuA4 complex subunit EAF3 homolog OS=Drosophila melanogaster OX=7227 GN=MRG15 PE=1 SV=1
10	H0YNE0	2.15e-56	182	213	0.319	0.432	H0YNE0_HUMAN Mortality factor 4 like 1 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L1 PE=1 SV=1
11	Q5JXX6	3.94e-40	135	67	0.233	1.000	Q5JXX6_HUMAN Mortality factor 4 like 2 (Fragment) OS=Homo sapiens OX=9606 GN=MORF4L2 PE=1 SV=1
12	O13953	4.65e-33	125	337	0.281	0.240	EAF3_SCHPO Chromatin modification-related protein eaf3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp13 PE=1 SV=1
13	Q94C32	4.45e-28	112	320	0.208	0.188	MRG1_ARATH Protein MRG1 OS=Arabidopsis thaliana OX=3702 GN=MRG1 PE=1 SV=1
14	Q12432	2.90e-25	105	401	0.281	0.202	EAF3_YEAST Chromatin modification-related protein EAF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EAF3 PE=1 SV=1
15	Q4V3E2	1.38e-22	97.4	327	0.208	0.183	MRG2_ARATH Protein MRG2 OS=Arabidopsis thaliana OX=3702 GN=MRG2 PE=1 SV=1
16	Q59K07	5.08e-20	90.9	369	0.163	0.127	EAF3_CANAL Chromatin modification-related protein EAF3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF3 PE=3 SV=1
17	A7DTF0	2.81e-19	88.2	337	0.229	0.196	MRG1_CAEEL Mortality factor related protein 1 OS=Caenorhabditis elegans OX=6239 GN=mrg-1 PE=1 SV=1
18	Q8N5Y2	4.29e-07	53.1	521	0.097	0.054	MS3L1_HUMAN Male-specific lethal 3 homolog OS=Homo sapiens OX=9606 GN=MSL3 PE=1 SV=1
19	Q9WVG9	4.71e-07	53.1	525	0.097	0.053	MS3L1_MOUSE Male-specific lethal 3 homolog OS=Mus musculus OX=10090 GN=Msl3 PE=1 SV=3
20	P50536	5.90e-04	43.5	512	0.076	0.043	MSL3_DROME Protein male-specific lethal-3 OS=Drosophila melanogaster OX=7227 GN=msl-3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05712 MRG	3e-48	175.4	MRG

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394417

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359518	0.999	MRG/MORF4L-binding protein
2	9606.ENSP00000340330	0.991	Histone acetyltransferase KAT5
3	9606.ENSP00000254900	0.988	Bromodomain-containing protein 8
4	9606.ENSP00000263062	0.986	Enhancer of polycomb homolog 1
5	9606.ENSP00000352925	0.986	Transformation/transcription domain-associated protein
6	9606.ENSP00000329933	0.982	PHD finger protein 12
7	9606.ENSP00000331310	0.979	Mortality factor 4-like protein 1
8	9606.ENSP00000361363	0.979	DNA methyltransferase 1-associated protein 1
9	9606.ENSP00000374213	0.977	E1A-binding protein p400
10	9606.ENSP00000261584	0.976	Partner and localizer of BRCA2
11	9606.ENSP00000247843	0.973	YEATS domain-containing protein 4
12	9606.ENSP00000397552	0.965	Actin-like protein 6A
13	9606.ENSP00000346464	0.964	Vacuolar protein sorting-associated protein 72 homolog
14	9606.ENSP00000258484	0.958	Enhancer of polycomb homolog 2
15	9606.ENSP00000318352	0.957	Morf4 family associated protein 1
16	9606.ENSP00000362649	0.951	Histone deacetylase 1
17	9606.ENSP00000362166	0.950	Chromatin modification-related protein MEAF6
18	9606.ENSP00000318297	0.943	RuvB-like 1
19	9606.ENSP00000320566	0.940	Inhibitor of growth protein 3
20	9606.ENSP00000332194	0.939	Histone H2A type 2-C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.401	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0019538	0.986	protein metabolic process
GO:0045935	0.985	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0016570	0.979	histone modification
GO:0043967	0.971	histone H4 acetylation
GO:0080135	0.961	regulation of cellular response to stress
GO:0051052	0.960	regulation of DNA metabolic process
GO:2001020	0.935	regulation of response to DNA damage stimulus
GO:0000018	0.930	regulation of DNA recombination
GO:0051054	0.929	positive regulation of DNA metabolic process
GO:0006282	0.922	regulation of DNA repair
GO:0048584	0.921	positive regulation of response to stimulus
GO:0045911	0.918	positive regulation of DNA recombination
GO:2001022	0.905	positive regulation of response to DNA damage stimulus
GO:2000779	0.905	regulation of double-strand break repair
GO:0010569	0.886	regulation of double-strand break repair via homologous recombination
GO:0045739	0.884	positive regulation of DNA repair
GO:2000781	0.856	positive regulation of double-strand break repair
GO:0051726	0.826	regulation of cell cycle
GO:0010468	0.816	regulation of gene expression
GO:0009987	0.785	cellular process
GO:0031326	0.732	regulation of cellular biosynthetic process
GO:0051252	0.728	regulation of RNA metabolic process
GO:0010556	0.641	regulation of macromolecule biosynthetic process
GO:0006355	0.614	regulation of DNA-templated transcription
GO:0006357	0.484	regulation of transcription by RNA polymerase II
GO:0009891	0.403	positive regulation of biosynthetic process
GO:0031328	0.304	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.998	protein-containing complex
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:1902562	0.981	H4 histone acetyltransferase complex
GO:0016020	0.947	membrane
GO:0071944	0.946	cell periphery
GO:0005886	0.944	plasma membrane
GO:0044815	0.915	DNA packaging complex
GO:0043189	0.859	H4/H2A histone acetyltransferase complex
GO:0000786	0.815	nucleosome
GO:0035267	0.675	NuA4 histone acetyltransferase complex
GO:0005737	0.672	cytoplasm
GO:0005730	0.441	nucleolus
GO:0140513	0.316	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]