StarFunc result for job id Q15020

User Input

>input (963 residues)
MATAAETSASEPEAESKAGPKADGEEDEVKAARTRRKVLSRAVAAATYKTMGPAWDQQEE
GVSESDGDEYAMASSAESSPGEYEWEYDEEEEKNQLEIERLEEQLSINVYDYNCHVDLIR
LLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAQDGLDREHVYDLFEKAVKDY
ICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLALWEAYREFESAIVE
AARLEKVHSLFRRQLAIPLYDMEATFAEYEEWSEDPIPESVIQNYNKALQQLEKYKPYEE
ALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRYSQYLDRQLKV
KDLVLSVHNRAIRNCPWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEI
WQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWAR
IEARLCNNMQKARELWDSIMTRGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSD
YPEHVCEVLLTMERTEGSLEDWDIAVQKTETRLARVNEQRMKAAEKEAALVQQEEEKAEQ
RKRARAEKKALKKKKKIRGPEKRGADEDDEKEWGDDEEEQPSKRRRVENSIPAAGETQNV
EVAAGPAGKCAAVDVEPPSKQKEKAASLKRDMPKVLHDSSKDSITVFVSNLPYSMQEPDT
KLRPLFEACGEVVQIRPIFSNRGDFRGYCYVEFKEEKSALQALEMDRKSVEGRPMFVSPC
VDKSKNPDFKVFRYSTSLEKHKLFISGLPFSCTKEELEEICKAHGTVKDLRLVTNRAGKP
KGLAYVEYENESQASQAVMKMDGMTIKENIIKVAISNPPQRKVPEKPETRKAPGGPMLLP
QTYGARGKGRTQLSLLPRALQRPSAAAPQAENGPAAAPAVAAPAATEAPKMSNADFAKLF
LRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A499FI31	0.583	0.572	0.000	981	0.995	0.977	A0A499FI31.pdb.gz	A0A499FI31_HUMAN Spliceosome associated factor 3, U4/U6 recycling protein OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1
2	AFDB:Q9JLI8	0.601	0.602	0.000	962	0.871	0.872	Q9JLI8.pdb.gz	SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus OX=10090 GN=Sart3 PE=1 SV=1
3	AFDB:B3DJT0	0.738	0.747	7.836E-88	951	0.590	0.597	B3DJT0.pdb.gz	SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio OX=7955 GN=sart3 PE=2 SV=1
4	AFDB:Q9USY2	0.412	0.393	9.261E-32	1014	0.167	0.159	Q9USY2.pdb.gz	YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1861.04c PE=4 SV=1
5	AFDB:Q9W4D2	0.383	0.392	5.078E-23	941	0.184	0.188	Q9W4D2.pdb.gz	RNP4F_DROME RNA-binding protein 4F OS=Drosophila melanogaster OX=7227 GN=Rnp4F PE=1 SV=1
6	AFDB:Q7KRW8	0.387	0.353	5.322E-14	1066	0.123	0.111	Q7KRW8.pdb.gz	PRP39_DROME Pre-mRNA-processing factor 39 OS=Drosophila melanogaster OX=7227 GN=Prp39 PE=1 SV=1
7	AFDB:P27476	0.087	0.193	5.480E-13	414	0.077	0.179	P27476.pdb.gz	NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSR1 PE=1 SV=1
8	AFDB:Q5AB84	0.084	0.194	7.414E-13	400	0.072	0.172	Q5AB84.pdb.gz	Q5AB84_CANAL RRM domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C100160CA PE=4 SV=1
9	AFDB:Q9ZUU4	0.116	0.279	1.300E-12	289	0.053	0.176	Q9ZUU4.pdb.gz	CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP29B PE=1 SV=1
10	AFDB:Q9FGS0	0.140	0.355	1.545E-12	289	0.056	0.187	Q9FGS0.pdb.gz	CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31B PE=1 SV=1
11	PDB:6uroE	0.328	0.550	3.209E-11	527	0.090	0.165	6uroE.pdb.gz	Structural Insights into the Human Pre-mRNA 3'-End Processing Machinery.
12	PDB:6n7pD	0.362	0.589	4.044E-9	544	0.083	0.147	6n7pD.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
13	PDB:7mq8LP	0.223	0.363	1.914E-8	567	0.084	0.143	7mq8LP.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5vsuA	0.087	0.196	2.823E-8	387	0.040	0.101	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
15	PDB:6y53o	0.101	0.442	3.988E-8	160	0.043	0.256	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:7evoD	0.080	0.375	4.949E-8	200	0.036	0.175	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6n7xE	0.309	0.467	1.731E-7	583	0.059	0.098	6n7xE.pdb.gz	CryoEM structure of Saccharomyces cerevisiae U1 snRNP offers insight into alternative splicing.
18	PDB:7oqcF	0.079	0.273	2.058E-7	267	0.039	0.142	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
19	PDB:5lsbA	0.089	0.407	4.476E-7	176	0.038	0.210	5lsbA.pdb.gz
20	PDB:6ff7X	0.080	0.430	1.707E-6	171	0.045	0.251	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A499FI31	0.0	1975	981	1.000	0.982	A0A499FI31_HUMAN Spliceosome associated factor 3, U4/U6 recycling protein OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1
2	B3DJT0	0.0	1135	951	0.579	0.587	SART3_DANRE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Danio rerio OX=7955 GN=sart3 PE=2 SV=1
3	Q15020	0.0	1987	963	1.000	1.000	SART3_HUMAN Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3 PE=1 SV=1
4	Q9JLI8	0.0	1638	962	0.871	0.872	SART3_MOUSE Squamous cell carcinoma antigen recognized by T-cells 3 OS=Mus musculus OX=10090 GN=Sart3 PE=1 SV=1
5	F4JQ75	4.09e-90	307	817	0.239	0.282	F4JQ75_ARATH EMBRYO DEFECTIVE 140 OS=Arabidopsis thaliana OX=3702 GN=EMB140 PE=1 SV=1
6	Q17430	8.82e-83	287	836	0.258	0.297	SART3_CAEEL Nuclear RNA-binding protein sart-3 OS=Caenorhabditis elegans OX=6239 GN=sart-3 PE=1 SV=1
7	Q9USY2	1.39e-36	152	1014	0.191	0.181	YOW4_SCHPO Uncharacterized RNA-binding protein C1861.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1861.04c PE=4 SV=1
8	Q9W4D2	3.18e-16	86.3	941	0.055	0.056	RNP4F_DROME RNA-binding protein 4F OS=Drosophila melanogaster OX=7227 GN=Rnp4F PE=1 SV=1
9	B8JLQ3	1.76e-14	80.1	704	0.060	0.082	B8JLQ3_DANRE Nucleolin OS=Danio rerio OX=7955 GN=wu:fa12d03 PE=1 SV=1
10	F1R6L6	1.76e-14	80.1	705	0.060	0.082	F1R6L6_DANRE Nucleolin OS=Danio rerio OX=7955 GN=fa12d03 PE=1 SV=1
11	P27476	3.61e-14	78.2	414	0.057	0.133	NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSR1 PE=1 SV=1
12	Q9FGS0	5.73e-12	69.7	289	0.052	0.173	CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31B PE=1 SV=1
13	F1QF98	2.07e-11	70.5	927	0.064	0.067	F1QF98_DANRE Probable RNA-binding protein 19 OS=Danio rerio OX=7955 GN=npo PE=1 SV=1
14	Q04836	2.03e-10	65.9	329	0.065	0.191	CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31A PE=1 SV=1
15	Q9VM49	2.65e-10	66.6	594	0.051	0.082	Q9VM49_DROME Caper, isoform A OS=Drosophila melanogaster OX=7227 GN=Caper PE=1 SV=1
16	K7EK33	5.72e-10	64.7	406	0.049	0.116	K7EK33_HUMAN DAZ associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=2
17	A0A0S2Z569	7.48e-10	64.7	407	0.047	0.111	A0A0S2Z569_HUMAN DAZ associated protein 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=DAZAP1 PE=2 SV=1
18	Q96EP5	7.48e-10	64.7	407	0.047	0.111	DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=1
19	K7EQ55	8.00e-10	64.3	406	0.047	0.111	K7EQ55_HUMAN DAZ associated protein 1 OS=Homo sapiens OX=9606 GN=DAZAP1 PE=1 SV=2
20	P26368	8.06e-10	64.7	475	0.060	0.122	U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08952 DUF1866	2e+02	13.3	Domain of unknown function (DUF1866)
2	PF09351 DUF1993	1.6e+02	13.9	Domain of unknown function (DUF1993)
3	PF05391 Lsm_interact	0.0069	27.1	Lsm interaction motif
4	PF16605 LSM_int_assoc	1.4e-23	94.1	LSM-interacting associated unstructured
5	PF05172 Nup35_RRM	1.8e+02	13.5	Nup53/35/40-type RNA recognition motif
6	PF14605 Nup35_RRM_2	1.8	20.0	Nup53/35/40-type RNA recognition motif
7	PF00076 RRM_1	1e-29	113.5	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
8	PF16367 RRM_7	3.4e+02	12.8	RNA recognition motif
9	PF16842 RRM_occluded	0.0073	27.5	Occluded RNA-recognition motif
10	PF05843 Suf	0.089	24.3	Suppressor of forked protein (Suf)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000228284

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280377	0.999	Ubiquitin carboxyl-terminal hydrolase 15
2	9606.ENSP00000249299	0.997	U6 snRNA-associated Sm-like protein LSm8
3	9606.ENSP00000265560	0.997	Ubiquitin carboxyl-terminal hydrolase 4
4	9606.ENSP00000469468	0.996	U6 snRNA-associated Sm-like protein LSm4
5	9606.ENSP00000364813	0.995	U6 snRNA-associated Sm-like protein LSm2
6	9606.ENSP00000252622	0.990	U6 snRNA-associated Sm-like protein LSm7
7	9606.ENSP00000422392	0.990	U6 snRNA-associated Sm-like protein LSm6
8	9606.ENSP00000302160	0.981	U6 snRNA-associated Sm-like protein LSm3
9	9606.ENSP00000308546	0.979	7SK snRNA methylphosphate capping enzyme
10	9606.ENSP00000315379	0.975	U4/U6 small nuclear ribonucleoprotein Prp3
11	9606.ENSP00000324122	0.973	U4/U6 small nuclear ribonucleoprotein Prp31
12	9606.ENSP00000410758	0.952	U6 snRNA-associated Sm-like protein LSm5
13	9606.ENSP00000363313	0.950	U4/U6 small nuclear ribonucleoprotein Prp4
14	9606.ENSP00000422626	0.946	La-related protein 7
15	9606.ENSP00000306614	0.911	Peptidyl-prolyl cis-trans isomerase H
16	9606.ENSP00000317123	0.876	U5 small nuclear ribonucleoprotein 200 kDa helicase
17	9606.ENSP00000308000	0.843	Speckle targeted PIP5K1A-regulated poly(A) polymerase
18	9606.ENSP00000457723	0.832	RNA-binding protein with serine-rich domain 1
19	9606.ENSP00000328773	0.830	Protein HEXIM1
20	9606.ENSP00000392094	0.829	116 kDa U5 small nuclear ribonucleoprotein component

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017069	1.000	snRNA binding
GO:0019899	0.996	enzyme binding
GO:0042393	0.991	histone binding
GO:1990381	0.990	ubiquitin-specific protease binding
GO:0017070	0.977	U6 snRNA binding
GO:0003729	0.763	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0010467	0.987	gene expression
GO:0090304	0.985	nucleic acid metabolic process
GO:0050789	0.977	regulation of biological process
GO:0000398	0.977	mRNA splicing, via spliceosome
GO:0019222	0.959	regulation of metabolic process
GO:0080090	0.948	regulation of primary metabolic process
GO:0022613	0.947	ribonucleoprotein complex biogenesis
GO:0060255	0.945	regulation of macromolecule metabolic process
GO:0051171	0.945	regulation of nitrogen compound metabolic process
GO:0022618	0.918	ribonucleoprotein complex assembly
GO:0048518	0.851	positive regulation of biological process
GO:0000387	0.806	spliceosomal snRNP assembly
GO:0071824	0.803	protein-DNA complex subunit organization
GO:0010604	0.793	positive regulation of macromolecule metabolic process
GO:0031056	0.755	regulation of histone modification
GO:0051173	0.734	positive regulation of nitrogen compound metabolic process
GO:0065004	0.687	protein-DNA complex assembly
GO:0010468	0.683	regulation of gene expression
GO:0006325	0.555	chromatin organization
GO:0050794	0.534	regulation of cellular process
GO:0051247	0.478	positive regulation of protein metabolic process
GO:1903320	0.466	regulation of protein modification by small protein conjugation or removal
GO:0006338	0.399	chromatin remodeling
GO:0031323	0.336	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.978	protein-containing complex
GO:0140513	0.903	nuclear protein-containing complex
GO:1990904	0.873	ribonucleoprotein complex
GO:0120114	0.819	Sm-like protein family complex
GO:0030532	0.796	small nuclear ribonucleoprotein complex
GO:0016604	0.791	nuclear body
GO:0015030	0.569	Cajal body
GO:0097525	0.492	spliceosomal snRNP complex
GO:0005737	0.452	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]