StarFunc result for job id Q15021

User Input

>input (1401 residues)
MAPQMYEFHLPLSPEELLKSGGVNQYVVQEVLSIKHLPPQLRAFQAAFRAQGPLAMLQHF
DTIYSILHHFRSIDPGLKEDTLQFLIKVVSRHSQELPAILDDTTLSGSDRNAHLNALKMN
CYALIRLLESFETMASQTNLVDLDLGGKGKKARTKAAHGFDWEEERQPILQLLTQLLQLD
IRHLWNHSIIEEEFVSLVTGCCYRLLENPTINHQKNRPTREAITHLLGVALTRYNHMLSA
TVKIIQMLQHFEHLAPVLVAAVSLWATDYGMKSIVGEIVREIGQKCPQELSRDPSGTKGF
AAFLTELAERVPAILMSSMCILLDHLDGENYMMRNAVLAAMAEMVLQVLSGDQLEAAARD
TRDQFLDTLQAHGHDVNSFVRSRVLQLFTRIVQQKALPLTRFQAVVALAVGRLADKSVLV
CKNAIQLLASFLANNPFSCKLSDADLAGPLQKETQKLQEMRAQRRTAAASAVLDPEEEWE
AMLPELKSTLQQLLQLPQGEEEIPEQIANTETTEDVKGRIYQLLAKASYKKAIILTREAT
GHFQESEPFSHIDPEESEETRLLNILGLIFKGPAASTQEKNPRESTGNMVTGQTVCKNKP
NMSDPEESRGNDELVKQEMLVQYLQDAYSFSRKITEAIGIISKMMYENTTTVVQEVIEFF
VMVFQFGVPQALFGVRRMLPLIWSKEPGVREAVLNAYRQLYLNPKGDSARAKAQALIQNL
SLLLVDASVGTIQCLEEILCEFVQKDELKPAVTQLLWERATEKVACCPLERCSSVMLLGM
MARGKPEIVGSNLDTLVSIGLDEKFPQDYRLAQQVCHAIANISDRRKPSLGKRHPPFRLP
QEHRLFERLRETVTKGFVHPDPLWIPFKEVAVTLIYQLAEGPEVICAQILQGCAKQALEK
LEEKRTSQEDPKESPAMLPTFLLMNLLSLAGDVALQQLVHLEQAVSGELCRRRVLREEQE
HKTKDPKEKNTSSETTMEEELGLVGATADDTEAELIRGICEMELLDGKQTLAAFVPLLLK
VCNNPGLYSNPDLSAAASLALGKFCMISATFCDSQLRLLFTMLEKSPLPIVRSNLMVATG
DLAIRFPNLVDPWTPHLYARLRDPAQQVRKTAGLVMTHLILKDMVKVKGQVSEMAVLLID
PEPQIAALAKNFFNELSHKGNAIYNLLPDIISRLSDPELGVEEEPFHTIMKQLLSYITKD
KQTESLVEKLCQRFRTSRTERQQRDLAYCVSQLPLTERGLRKMLDNFDCFGDKLSDESIF
SAFLSVVGKLRRGAKPEGKAIIDEFEQKLRACHTRGLDGIKELEIGQAGSQRAPSAKKPS
TGSRYQPLASTASDNDFVTPEPRRTTRRHPNTQQRASKKKPKVVFSSDESSEEDLSAEMT
EDETPKKTTPILRASARRHRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15021	1.000	1.000	0.000	1401	1.000	1.000	Q15021.pdb.gz	CND1_HUMAN Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3
2	AFDB:Q8K2Z4	0.897	0.903	0.000	1392	0.859	0.865	Q8K2Z4.pdb.gz	CND1_MOUSE Condensin complex subunit 1 OS=Mus musculus OX=10090 GN=Ncapd2 PE=1 SV=2
3	AFDB:Q9YHY6	0.807	0.828	0.000	1364	0.597	0.613	Q9YHY6.pdb.gz	CND1_XENLA Condensin complex subunit 1 OS=Xenopus laevis OX=8355 GN=ncapd2 PE=1 SV=1
4	AFDB:A0A0R4IRW7	0.734	0.732	1.165E-93	1404	0.498	0.497	A0A0R4IRW7.pdb.gz
5	AFDB:Q9VAJ1	0.635	0.644	6.181E-61	1380	0.279	0.283	Q9VAJ1.pdb.gz	Q9VAJ1_DROME Condensin complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cap-D2 PE=1 SV=1
6	AFDB:F4J246	0.731	0.724	1.044E-55	1415	0.254	0.252	F4J246.pdb.gz	F4J246_ARATH Condensin-1 complex subunit CAP-D2 OS=Arabidopsis thaliana OX=3702 GN=At3g57060 PE=1 SV=1
7	AFDB:O94679	0.669	0.802	2.030E-43	1158	0.210	0.254	O94679.pdb.gz	CND1_SCHPO Condensin complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd1 PE=1 SV=1
8	AFDB:Q06156	0.656	0.774	5.836E-43	1176	0.205	0.244	Q06156.pdb.gz	CND1_YEAST Condensin complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCS4 PE=1 SV=1
9	PDB:7qenD	0.634	0.828	5.235E-37	1050	0.194	0.259	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
10	AFDB:Q9U2M1	0.576	0.545	1.199E-36	1499	0.180	0.168	Q9U2M1.pdb.gz	CND1_CAEEL Condensin complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dpy-28 PE=1 SV=2
11	PDB:7q2xD	0.614	0.844	6.733E-35	994	0.184	0.260	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
12	PDB:6yvuD	0.495	0.769	2.482E-20	866	0.161	0.260	6yvuD.pdb.gz
13	AFDB:Q6ZQK0	0.368	0.347	3.562E-17	1506	0.149	0.139	Q6ZQK0.pdb.gz	CNDD3_MOUSE Condensin-2 complex subunit D3 OS=Mus musculus OX=10090 GN=Ncapd3 PE=1 SV=3
14	PDB:4a0cA	0.168	0.193	5.337E-10	1155	0.110	0.133	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
15	PDB:4jlqA	0.143	0.210	1.333E-9	840	0.089	0.149	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
16	PDB:6zz6D	0.377	0.471	5.844E-9	1050	0.099	0.131	6zz6D.pdb.gz	Transport of DNA within cohesin involves clamping on top of engaged heads by Scc2 and entrapment within the ring by Scc3.
17	PDB:1qgkA	0.157	0.221	9.234E-9	876	0.107	0.171	1qgkA.pdb.gz
18	PDB:7qfwA	0.286	0.435	2.388E-8	823	0.090	0.153	7qfwA.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
19	PDB:6tc0C	0.199	0.247	3.278E-8	994	0.105	0.148	6tc0C.pdb.gz
20	PDB:7ni5A	0.142	0.095	6.177E-8	2791	0.118	0.059	7ni5A.pdb.gz	Molecular basis of human ATM kinase inhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EN77	0.0	1752	919	0.607	0.926	E7EN77_HUMAN Non-SMC condensin I complex subunit D2 (Fragment) OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=2
2	Q15021	0.0	2890	1401	1.000	1.000	CND1_HUMAN Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3
3	Q8K2Z4	0.0	2445	1392	0.861	0.866	CND1_MOUSE Condensin complex subunit 1 OS=Mus musculus OX=10090 GN=Ncapd2 PE=1 SV=2
4	Q9YHY6	0.0	1661	1364	0.597	0.613	CND1_XENLA Condensin complex subunit 1 OS=Xenopus laevis OX=8355 GN=ncapd2 PE=1 SV=1
5	Q9VAJ1	6.59e-179	571	1380	0.278	0.282	Q9VAJ1_DROME Condensin complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Cap-D2 PE=1 SV=1
6	A0A1I9LM04	5.11e-102	359	1410	0.170	0.169	CNDD2_ARATH Condensin-1 complex subunit CAP-D2 OS=Arabidopsis thaliana OX=3702 GN=CAP-D2 PE=2 SV=1
7	F4J246	5.79e-102	358	1415	0.170	0.168	F4J246_ARATH Condensin-1 complex subunit CAP-D2 OS=Arabidopsis thaliana OX=3702 GN=At3g57060 PE=1 SV=1
8	Q06156	2.11e-78	285	1176	0.141	0.168	CND1_YEAST Condensin complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCS4 PE=1 SV=1
9	O94679	1.94e-75	276	1158	0.143	0.174	CND1_SCHPO Condensin complex subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cnd1 PE=1 SV=1
10	Q38F58	4.36e-30	132	1258	0.095	0.106	Q38F58_TRYB2 Condensin subunit 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3470 PE=4 SV=1
11	Q9U2M1	1.25e-22	108	1499	0.106	0.099	CND1_CAEEL Condensin complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dpy-28 PE=1 SV=2
12	O24610	2.08e-09	65.1	1314	0.026	0.028	CNDD3_ARATH Condensin-2 complex subunit CAP-D3 OS=Arabidopsis thaliana OX=3702 GN=CAP-D3 PE=2 SV=2
13	Q6GN08	1.83e-08	62.0	1492	0.030	0.028	CND3L_XENLA Condensin-2 complex subunit D3-L OS=Xenopus laevis OX=8355 GN=ncapd3.L PE=1 SV=1
14	Q6ZQK0	7.94e-08	59.7	1506	0.028	0.026	CNDD3_MOUSE Condensin-2 complex subunit D3 OS=Mus musculus OX=10090 GN=Ncapd3 PE=1 SV=3
15	P42695	1.65e-07	58.5	1498	0.027	0.025	CNDD3_HUMAN Condensin-2 complex subunit D3 OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2
16	Q96FA6	1.52e-05	52.0	558	0.021	0.052	Q96FA6_HUMAN NCAPD3 protein (Fragment) OS=Homo sapiens OX=9606 GN=NCAPD3 PE=1 SV=2
17	Q57UQ3	0.053	39.3	231	0.030	0.182	Q57UQ3_TRYB2 Enriched in surface-labeled proteome protein 12 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.300 PE=4 SV=1
18	Q5BBG0	1.5	35.8	1093	0.012	0.016	Q5BBG0_EMENI Importin subunit beta-4, putative (JCVI) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02120 PE=4 SV=1
19	Q9C9R6	1.8	35.4	650	0.043	0.092	PUM7_ARATH Putative pumilio homolog 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=APUM7 PE=3 SV=2
20	Q95Y84	1.9	35.4	1758	0.019	0.015	CND_CAEEL Condensin-2 complex subunit hcp-6 OS=Caenorhabditis elegans OX=6239 GN=hcp-6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	9.4e-05	32.8	Adaptin N terminal region
2	PF12717 Cnd1	8.6e-48	173.9	non-SMC mitotic condensation complex subunit 1
3	PF12922 Cnd1_N	5e-35	132.3	non-SMC mitotic condensation complex subunit 1, N-term
4	PF12719 Cnd3	2.1e+02	12.5	Nuclear condensing complex subunits, C-term domain
5	PF09724 Dcc1	15	16.3	Sister chromatid cohesion protein Dcc1
6	PF02985 HEAT	3.6	19.1	HEAT repeat
7	PF03788 LrgA	59	15.1	LrgA family
8	PF20168 PDS5	4.5	16.6	Sister chromatid cohesion protein PDS5 protein
9	PF08585 RMI1_N	2.6e+02	12.8	RecQ mediated genome instability protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325017

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240423	0.999	Condensin complex subunit 2
2	9606.ENSP00000251496	0.999	Condensin complex subunit 3
3	9606.ENSP00000286398	0.999	Structural maintenance of chromosomes protein 2
4	9606.ENSP00000349961	0.999	Structural maintenance of chromosomes protein 4
5	9606.ENSP00000378699	0.994	Cyclin-dependent kinase 1
6	9606.ENSP00000313950	0.990	Aurora kinase B
7	9606.ENSP00000387007	0.990	Condensin-2 complex subunit G2
8	9606.ENSP00000433681	0.984	Condensin-2 complex subunit D3
9	9606.ENSP00000356379	0.974	Abnormal spindle-like microcephaly-associated protein
10	9606.ENSP00000256442	0.972	G2/mitotic-specific cyclin-B1
11	9606.ENSP00000288207	0.972	G2/mitotic-specific cyclin-B2
12	9606.ENSP00000299821	0.957	Condensin-2 complex subunit H2
13	9606.ENSP00000269701	0.948	A-kinase anchor protein 8
14	9606.ENSP00000361540	0.940	Cell division cycle protein 20 homolog
15	9606.ENSP00000274026	0.939	Cyclin-A2
16	9606.ENSP00000260731	0.936	Kinesin-like protein KIF11
17	9606.ENSP00000368349	0.930	DNA polymerase alpha catalytic subunit
18	9606.ENSP00000296509	0.925	Mitotic spindle assembly checkpoint protein MAD2A
19	9606.ENSP00000300093	0.925	Serine/threonine-protein kinase PLK1
20	9606.ENSP00000362146	0.922	Borealin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	0.999	histone binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071840	0.995	cellular component organization or biogenesis
GO:0050794	0.994	regulation of cellular process
GO:0051276	0.990	chromosome organization
GO:0007059	0.986	chromosome segregation
GO:0048285	0.967	organelle fission
GO:0098813	0.962	nuclear chromosome segregation
GO:0048522	0.948	positive regulation of cellular process
GO:1903047	0.939	mitotic cell cycle process
GO:0000280	0.938	nuclear division
GO:0000819	0.884	sister chromatid segregation
GO:0140014	0.852	mitotic nuclear division
GO:0033044	0.826	regulation of chromosome organization
GO:0000070	0.774	mitotic sister chromatid segregation
GO:0030261	0.705	chromosome condensation
GO:0051726	0.568	regulation of cell cycle
GO:0010564	0.444	regulation of cell cycle process
GO:0051130	0.350	positive regulation of cellular component organization
GO:0045787	0.308	positive regulation of cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005694	1.000	chromosome
GO:0005654	1.000	nucleoplasm
GO:0005829	0.999	cytosol
GO:0000228	0.982	nuclear chromosome
GO:0000796	0.981	condensin complex
GO:0016020	0.951	membrane
GO:0000793	0.935	condensed chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]