StarFunc result for job id Q15022

User Input

>input (739 residues)
MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAVAAATASGGKSGGGSCGGGGSYSASSSSSA
AAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRTRNLIAPIFLHRTLTYMSH
RNSRTNIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFTGFFHKNDKPSPNSENEQN
SVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPS
NSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVNEELPARRKRNREDGEKTFVAQMT
VFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLR
WTGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQTRKEKDTPN
ENRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVY
HPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASM
SEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQI
EEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHL
VSMHDFNLISIMSIDKAVTKLREMQQKLEKGESASPANEEITEEQNGTANGFSEINSKEK
ALETDSVSGVSKQSKKQKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3QQW9	0.678	0.697	0.000	716	0.963	0.994	J3QQW9.pdb.gz	J3QQW9_HUMAN SUZ12 polycomb repressive complex 2 subunit OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=1
2	AFDB:Q80U70	0.868	0.866	0.000	741	0.970	0.968	Q80U70.pdb.gz	SUZ12_MOUSE Polycomb protein Suz12 OS=Mus musculus OX=10090 GN=Suz12 PE=1 SV=2
3	AFDB:A0A0G2K2I0	0.775	0.774	1.539E-102	740	0.846	0.845	A0A0G2K2I0.pdb.gz	A0A0G2K2I0_RAT SUZ12 polycomb repressive complex 2 subunit OS=Rattus norvegicus OX=10116 GN=Suz12 PE=1 SV=2
4	AFDB:Q9NJG9	0.631	0.525	5.278E-59	900	0.364	0.299	Q9NJG9.pdb.gz	SUZ12_DROME Polycomb protein Su(z)12 OS=Drosophila melanogaster OX=7227 GN=Su(z)12 PE=1 SV=1
5	PDB:6wkrA	0.563	0.933	2.346E-58	439	0.579	0.975	6wkrA.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
6	PDB:7ksoC	0.546	0.941	2.628E-55	420	0.562	0.988	7ksoC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
7	PDB:7ksrC	0.231	0.404	1.634E-49	397	0.536	0.997	7ksrC.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
8	AFDB:Q8L6Y4	0.215	0.244	1.328E-17	631	0.149	0.174	Q8L6Y4.pdb.gz	EMF2_ARATH Polycomb group protein EMBRYONIC FLOWER 2 OS=Arabidopsis thaliana OX=3702 GN=EMF2 PE=1 SV=2
9	PDB:5wg6A	0.171	0.243	1.773E-15	517	0.172	0.246	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
10	AFDB:Q8W5B1	0.171	0.281	2.467E-13	440	0.096	0.161	Q8W5B1.pdb.gz	VRN2_ARATH Polycomb group protein VERNALIZATION 2 OS=Arabidopsis thaliana OX=3702 GN=VRN2 PE=1 SV=2
11	PDB:5wj9A	0.075	0.102	9.673E-3	479	0.046	0.071	5wj9A.pdb.gz	Human TRPML1 channel structures in open and closed conformations.
12	AFDB:O42967	0.055	0.064	4.245E-2	603	0.110	0.134	O42967.pdb.gz	YB92_SCHPO Uncharacterized ubiquitin-like protein C1E8.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1E8.02 PE=1 SV=1
13	PDB:1cjyA	0.102	0.116	4.632E-2	633	0.027	0.032	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
14	PDB:7kzpQ	0.076	0.075	1.991E-1	754	0.022	0.021	7kzpQ.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
15	AFDB:F4IDB2	0.068	0.044	2.033E-1	1325	0.069	0.038	F4IDB2.pdb.gz	PHL_ARATH Protein PHYTOCHROME-DEPENDENT LATE-FLOWERING OS=Arabidopsis thaliana OX=3702 GN=PHL PE=1 SV=1
16	AFDB:Q8IYF1	0.063	0.063	2.391E-1	753	0.127	0.125	Q8IYF1.pdb.gz	ELOA2_HUMAN Elongin-A2 OS=Homo sapiens OX=9606 GN=ELOA2 PE=1 SV=2
17	AFDB:O22864	0.075	0.061	2.811E-1	947	0.072	0.056	O22864.pdb.gz	NLP8_ARATH Protein NLP8 OS=Arabidopsis thaliana OX=3702 GN=NLP8 PE=2 SV=1
18	PDB:4pdeA	0.060	0.145	3.807E-1	244	0.009	0.029	4pdeA.pdb.gz	Sulphur shuttling across a chaperone during molybdenum cofactor maturation.
19	PDB:6umxA	0.081	0.182	3.807E-1	279	0.012	0.032	6umxA.pdb.gz
20	PDB:5nxsA	0.078	0.148	4.241E-1	290	0.028	0.072	5nxsA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JV08	0.0	1444	715	0.942	0.973	A0A0G2JV08_RAT SUZ12 polycomb repressive complex 2 subunit OS=Rattus norvegicus OX=10116 GN=Suz12 PE=1 SV=2
2	A0A0G2K2I0	0.0	1070	675	0.724	0.793	A0A0G2K2I0_RAT SUZ12 polycomb repressive complex 2 subunit OS=Rattus norvegicus OX=10116 GN=Suz12 PE=1 SV=2
3	A0A8I6AIG5	0.0	1504	738	0.973	0.974	A0A8I6AIG5_RAT SUZ12 polycomb repressive complex 2 subunit OS=Rattus norvegicus OX=10116 GN=Suz12 PE=1 SV=1
4	J3QQW9	0.0	1489	716	0.969	1.000	J3QQW9_HUMAN SUZ12 polycomb repressive complex 2 subunit OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=1
5	Q15022	0.0	1548	739	1.000	1.000	SUZ12_HUMAN Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=3
6	Q80U70	0.0	1509	741	0.972	0.969	SUZ12_MOUSE Polycomb protein Suz12 OS=Mus musculus OX=10090 GN=Suz12 PE=1 SV=2
7	Q9NJG9	6.00e-144	446	900	0.350	0.288	SUZ12_DROME Polycomb protein Su(z)12 OS=Drosophila melanogaster OX=7227 GN=Su(z)12 PE=1 SV=1
8	Q69KN0	3.47e-07	56.2	604	0.089	0.109	EMF2B_ORYSJ Polycomb group protein EMF2B OS=Oryza sativa subsp. japonica OX=39947 GN=EMF2B PE=1 SV=1
9	Q8W5B1	1.95e-04	47.0	440	0.035	0.059	VRN2_ARATH Polycomb group protein VERNALIZATION 2 OS=Arabidopsis thaliana OX=3702 GN=VRN2 PE=1 SV=2
10	Q8L6Y4	0.003	43.5	631	0.030	0.035	EMF2_ARATH Polycomb group protein EMBRYONIC FLOWER 2 OS=Arabidopsis thaliana OX=3702 GN=EMF2 PE=1 SV=2
11	Q9HWS1	0.18	36.2	155	0.034	0.161	Q9HWS1_PSEAE EF-hand domain-containing protein OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA4107 PE=4 SV=1
12	A8J3B6	4.5	33.1	1024	0.042	0.030	A8J3B6_CHLRE Uncharacterized protein OS=Chlamydomonas reinhardtii OX=3055 GN=CHLRE_16g674515v5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09843 DUF2070	7.7	16.3	Predicted membrane protein (DUF2070)
2	PF19038 Fuz_longin_3	4e+02	13.1	Third Longin domain of FUZ, MON1 and HPS1
3	PF09733 VEFS-Box	1.3e-50	182.2	VEFS-Box of polycomb protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000316578

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263360	0.999	Polycomb protein EED
2	9606.ENSP00000320147	0.999	Histone-lysine N-methyltransferase EZH2
3	9606.ENSP00000341280	0.999	Protein Jumonji
4	9606.ENSP00000362592	0.999	Histone-binding protein RBBP4
5	9606.ENSP00000369424	0.999	Histone-binding protein RBBP7
6	9606.ENSP00000381840	0.999	Zinc finger protein AEBP2
7	9606.ENSP00000404658	0.999	Histone-lysine N-methyltransferase EZH1
8	9606.ENSP00000359321	0.997	Metal-response element-binding transcription factor 2
9	9606.ENSP00000483946	0.997	PHD finger protein 19
10	9606.ENSP00000216133	0.996	Chromobox protein homolog 7
11	9606.ENSP00000430432	0.995	Histone deacetylase 2
12	9606.ENSP00000262238	0.992	Transcriptional repressor protein YY1
13	9606.ENSP00000264010	0.992	Transcriptional repressor CTCF
14	9606.ENSP00000356480	0.991	E3 ubiquitin-protein ligase RING2
15	9606.ENSP00000362649	0.991	Histone deacetylase 1
16	9606.ENSP00000363640	0.988	PHD finger protein 1
17	9606.ENSP00000365851	0.983	Polycomb complex protein BMI-1
18	9606.ENSP00000363787	0.981	E3 ubiquitin-protein ligase RING1
19	9606.ENSP00000473391	0.981	annotation not available
20	9606.ENSP00000367203	0.979	Lysine-specific demethylase 6A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.552	organic cyclic compound binding
GO:0003676	0.455	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0080090	0.986	regulation of primary metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0048583	0.980	regulation of response to stimulus
GO:0071704	0.978	organic substance metabolic process
GO:0044238	0.974	primary metabolic process
GO:0048523	0.968	negative regulation of cellular process
GO:0006807	0.965	nitrogen compound metabolic process
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0043170	0.958	macromolecule metabolic process
GO:0031323	0.958	regulation of cellular metabolic process
GO:0010605	0.956	negative regulation of macromolecule metabolic process
GO:0016570	0.949	histone modification
GO:0051246	0.939	regulation of protein metabolic process
GO:0051172	0.933	negative regulation of nitrogen compound metabolic process
GO:0031324	0.933	negative regulation of cellular metabolic process
GO:0044237	0.924	cellular metabolic process
GO:0032259	0.920	methylation
GO:0032502	0.888	developmental process
GO:0031399	0.881	regulation of protein modification process
GO:0043414	0.875	macromolecule methylation
GO:0048585	0.871	negative regulation of response to stimulus
GO:0009966	0.868	regulation of signal transduction
GO:0032501	0.835	multicellular organismal process
GO:0048856	0.833	anatomical structure development
GO:0042127	0.828	regulation of cell population proliferation
GO:0008213	0.810	protein alkylation
GO:0050896	0.809	response to stimulus
GO:0006479	0.796	protein methylation
GO:0007275	0.794	multicellular organism development
GO:0051239	0.792	regulation of multicellular organismal process
GO:0016571	0.782	histone methylation
GO:0019219	0.761	regulation of nucleobase-containing compound metabolic process
GO:0010648	0.755	negative regulation of cell communication
GO:0009968	0.746	negative regulation of signal transduction
GO:0031326	0.736	regulation of cellular biosynthetic process
GO:0010556	0.731	regulation of macromolecule biosynthetic process
GO:0010629	0.730	negative regulation of gene expression
GO:0019220	0.709	regulation of phosphate metabolic process
GO:0031400	0.691	negative regulation of protein modification process
GO:0051252	0.683	regulation of RNA metabolic process
GO:0042325	0.669	regulation of phosphorylation
GO:0001932	0.659	regulation of protein phosphorylation
GO:1903506	0.616	regulation of nucleic acid-templated transcription
GO:0006355	0.613	regulation of DNA-templated transcription
GO:0050730	0.591	regulation of peptidyl-tyrosine phosphorylation
GO:0051241	0.573	negative regulation of multicellular organismal process
GO:0048518	0.561	positive regulation of biological process
GO:0048731	0.539	system development
GO:0018205	0.516	peptidyl-lysine modification
GO:0042326	0.506	negative regulation of phosphorylation
GO:1904892	0.504	regulation of receptor signaling pathway via STAT
GO:0007399	0.499	nervous system development
GO:0001933	0.499	negative regulation of protein phosphorylation
GO:1904893	0.493	negative regulation of receptor signaling pathway via STAT
GO:0071840	0.490	cellular component organization or biogenesis
GO:0008285	0.480	negative regulation of cell population proliferation
GO:0050793	0.464	regulation of developmental process
GO:0048522	0.463	positive regulation of cellular process
GO:0016043	0.450	cellular component organization
GO:0050732	0.433	negative regulation of peptidyl-tyrosine phosphorylation
GO:0042221	0.412	response to chemical
GO:0007417	0.395	central nervous system development
GO:0031327	0.394	negative regulation of cellular biosynthetic process
GO:0010558	0.385	negative regulation of macromolecule biosynthetic process
GO:0051253	0.385	negative regulation of RNA metabolic process
GO:0006325	0.380	chromatin organization
GO:0045892	0.378	negative regulation of DNA-templated transcription
GO:0010033	0.375	response to organic substance
GO:0018022	0.363	peptidyl-lysine methylation
GO:0006357	0.345	regulation of transcription by RNA polymerase II
GO:0050678	0.329	regulation of epithelial cell proliferation
GO:0050680	0.324	negative regulation of epithelial cell proliferation
GO:0046425	0.315	regulation of receptor signaling pathway via JAK-STAT
GO:0042509	0.312	regulation of tyrosine phosphorylation of STAT protein
GO:0032526	0.304	response to retinoic acid

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0140513	0.964	nuclear protein-containing complex
GO:0005730	0.949	nucleolus
GO:1902494	0.936	catalytic complex
GO:0016604	0.926	nuclear body
GO:1990234	0.879	transferase complex
GO:0031519	0.796	PcG protein complex
GO:0035097	0.763	histone methyltransferase complex
GO:0005737	0.688	cytoplasm
GO:0035098	0.535	ESC/E(Z) complex
GO:0005694	0.359	chromosome
GO:0005829	0.300	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]