StarFunc result for job id Q15025

User Input

>input (636 residues)
MEGRGPYRIYDPGGSVPSGEASAAFERLVKENSRLKEKMQGIKMLGELLEESQMEATRLR
QKAEELVKDNELLPPPSPSLGSFDPLAELTGKDSNVTASPTAPACPSDKPAPVQKPPSSG
TSSEFEVVTPEEQNSPESSSHANAMALGPLPREDGNLMLHLQRLETTLSVCAEEPDHGQL
FTHLGRMALEFNRLASKVHKNEQRTSILQTLCEQLRKENEALKAKLDKGLEQRDQAAERL
REENLELKKLLMSNGNKEGASGRPGSPKMEGTGKKAVAGQQQASVTAGKVPEVVALGAAE
KKVKMLEQQRSELLEVNKQWDQHFRSMKQQYEQKITELRQKLADLQKQVTDLEAEREQKQ
RDFDRKLLLAKSKIEMEETDKEQLTAEAKELRQKVKYLQDQLSPLTRQREYQEKEIQRLN
KALEEALSIQTPPSSPPTAFGSPEGAGALLRKQELVTQNELLKQQVKIFEEDFQRERSDR
ERMNEEKEELKKQVEKLQAQVTLSNAQLKAFKDEEKAREALRQQKRKAKASGERYHVEPH
PEHLCGAYPYAYPPMPAMVPHHGFEDWSQIRYPPPPMAMEHPPPLPNSRLFHLPEYTWRL
PCGGVRNPNQSSQVMDPPTARPTEPESPKNDREGPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15025	1.000	1.000	1.702E-87	636	1.000	1.000	Q15025.pdb.gz	TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=2
2	AFDB:Q9WUU8	0.439	0.433	1.208E-70	647	0.841	0.827	Q9WUU8.pdb.gz	TNIP1_MOUSE TNFAIP3-interacting protein 1 OS=Mus musculus OX=10090 GN=Tnip1 PE=1 SV=1
3	AFDB:F1QHG7	0.126	0.131	6.050E-4	602	0.171	0.181	F1QHG7.pdb.gz	F1QHG7_DANRE Inhibitor of nuclear factor kappa B kinase regulatory subunit gamma (Fragment) OS=Danio rerio OX=7955 GN=fj33c07 PE=1 SV=1
4	AFDB:A0A1B0GWK2	0.096	0.073	1.175E-3	863	0.124	0.092	A0A1B0GWK2.pdb.gz	A0A1B0GWK2_HUMAN Kazrin, periplakin interacting protein OS=Homo sapiens OX=9606 GN=KAZN PE=1 SV=1
5	AFDB:Q57Y10	0.089	0.064	4.118E-3	943	0.127	0.086	Q57Y10.pdb.gz	Q57Y10_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.490 PE=4 SV=1
6	AFDB:Q54Q13	0.082	0.054	5.532E-3	1056	0.123	0.074	Q54Q13.pdb.gz	Q54Q13_DICDI Ras GTPase activation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284177 PE=4 SV=1
7	AFDB:E7F789	0.137	0.091	7.999E-3	1011	0.173	0.109	E7F789.pdb.gz
8	AFDB:P86732	0.105	0.122	9.271E-3	507	0.086	0.108	P86732.pdb.gz	GAAP_HALAI Glycine, alanine and asparagine-rich protein OS=Haliotis asinina OX=109174 PE=1 SV=1
9	AFDB:Q57YQ5	0.112	0.092	1.074E-2	833	0.168	0.128	Q57YQ5.pdb.gz	Q57YQ5_TRYB2 200 kDa antigen p200 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.830 PE=4 SV=1
10	AFDB:A2ASQ4	0.137	0.085	1.245E-2	1035	0.195	0.120	A2ASQ4.pdb.gz
11	PDB:2ymbD	0.070	0.190	9.813E-1	231	0.009	0.026	2ymbD.pdb.gz	Escrt-III Binding Protein Mitd1 is Involved in Cytokinesis and Has an Unanticipated Pld Fold that Binds Membranes.
12	PDB:5oqmi	0.080	0.352	1.645	136	0.024	0.110	5oqmi.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
13	PDB:6w6hC	0.089	0.089	1.771	636	0.017	0.017	6w6hC.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
14	PDB:7n6g3I	0.107	0.157	2.052	401	0.082	0.130	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
15	PDB:2v6l0	0.060	0.323	2.209	82	0.024	0.183	2v6l0.pdb.gz
16	PDB:5svaU	0.091	0.283	2.378	156	0.022	0.090	5svaU.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
17	PDB:6u424R	0.121	0.199	2.378	366	0.099	0.172	6u424R.pdb.gz	Structure of the Decorated Ciliary Doublet Microtubule.
18	PDB:7enag	0.085	0.301	2.378	166	0.022	0.084	7enag.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
19	PDB:1u2mC	0.078	0.332	2.560	143	0.009	0.042	1u2mC.pdb.gz
20	PDB:6edtD	0.063	0.035	2.560	1270	0.017	0.009	6edtD.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRZ4	0.0	1197	619	0.936	0.961	A0A0A0MRZ4_HUMAN TNFAIP3 interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=1
2	E7EW15	0.0	516	257	0.404	1.000	E7EW15_HUMAN TNFAIP3 interacting protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=1
3	Q15025	0.0	1291	636	1.000	1.000	TNIP1_HUMAN TNFAIP3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TNIP1 PE=1 SV=2
4	Q9WUU8	0.0	1020	647	0.841	0.827	TNIP1_MOUSE TNFAIP3-interacting protein 1 OS=Mus musculus OX=10090 GN=Tnip1 PE=1 SV=1
5	Q96KP6	1.82e-41	155	325	0.151	0.295	TNIP3_HUMAN TNFAIP3-interacting protein 3 OS=Homo sapiens OX=9606 GN=TNIP3 PE=1 SV=2
6	A6H5Y1	2.24e-05	50.1	991	0.101	0.065	MPP9_MOUSE M-phase phosphoprotein 9 OS=Mus musculus OX=10090 GN=Mphosph9 PE=2 SV=2
7	Q99JG7	1.08e-04	47.4	430	0.052	0.077	TNIP2_MOUSE TNFAIP3-interacting protein 2 OS=Mus musculus OX=10090 GN=Tnip2 PE=1 SV=1
8	Q9CW03	3.08e-04	46.6	1217	0.074	0.039	SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus OX=10090 GN=Smc3 PE=1 SV=2
9	P97690	3.15e-04	46.6	1191	0.074	0.039	SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus OX=10116 GN=Smc3 PE=1 SV=1
10	Q9UQE7	3.24e-04	46.6	1217	0.074	0.039	SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2
11	O93309	0.002	43.9	1209	0.072	0.038	SMC3_XENLA Structural maintenance of chromosomes protein 3 OS=Xenopus laevis OX=8355 GN=smc3 PE=1 SV=2
12	Q8AWB8	0.002	43.9	1217	0.072	0.038	Q8AWB8_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC3 PE=2 SV=1
13	Q8NFZ5	0.002	43.5	429	0.052	0.077	TNIP2_HUMAN TNFAIP3-interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2 PE=1 SV=1
14	F6ZDS4	0.008	42.0	2431	0.135	0.035	TPR_MOUSE Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1
15	Q99550	0.014	41.2	1031	0.094	0.058	MPP9_HUMAN M-phase phosphoprotein 9 OS=Homo sapiens OX=9606 GN=MPHOSPH9 PE=1 SV=6
16	Q803N2	0.023	40.4	1216	0.072	0.038	Q803N2_DANRE Structural maintenance of chromosomes protein OS=Danio rerio OX=7955 GN=wu:fc30d07 PE=1 SV=1
17	P12270	0.026	40.4	2363	0.113	0.030	TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3
18	Q6P9Q6	0.045	39.7	1216	0.069	0.036	FKB15_MOUSE FK506-binding protein 15 OS=Mus musculus OX=10090 GN=Fkbp15 PE=1 SV=2
19	Q9GYV5	0.058	38.5	387	0.093	0.152	NEMO_DROME NF-kappa-B essential modulator OS=Drosophila melanogaster OX=7227 GN=key PE=1 SV=1
20	O88522	0.063	38.5	412	0.082	0.126	NEMO_MOUSE NF-kappa-B essential modulator OS=Mus musculus OX=10090 GN=Ikbkg PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	39	15.9	Autophagy protein 16 (ATG16)
2	PF16516 CC2-LZ	0.00082	31.0	Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator
3	PF00038 Filament	49	15.0	Intermediate filament protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317891

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000481570	0.999	Tumor necrosis factor alpha-induced protein 3
2	9606.ENSP00000483825	0.982	NF-kappa-B essential modulator
3	9606.ENSP00000441543	0.879	Polyubiquitin-C
4	9606.ENSP00000368022	0.874	Optineurin
5	9606.ENSP00000162749	0.858	Tumor necrosis factor receptor superfamily member 1A
6	9606.ENSP00000226574	0.843	Nuclear factor NF-kappa-B p105 subunit
7	9606.ENSP00000398698	0.828	Tumor necrosis factor
8	9606.ENSP00000379612	0.782	Tax1-binding protein 1
9	9606.ENSP00000228463	0.730	P-selectin glycoprotein ligand 1
10	9606.ENSP00000321203	0.719	TNFAIP3-interacting protein 2
11	9606.ENSP00000401399	0.697	Myeloid differentiation primary response protein MyD88
12	9606.ENSP00000215832	0.688	Mitogen-activated protein kinase 1
13	9606.ENSP00000244061	0.654	E3 ubiquitin-protein ligase RNF114
14	9606.ENSP00000366563	0.654	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
15	9606.ENSP00000357750	0.653	Adapter protein CIKS
16	9606.ENSP00000362994	0.651	TNF receptor-associated factor 1
17	9606.ENSP00000454207	0.646	TNF receptor-associated factor 3
18	9606.ENSP00000329967	0.627	Serine/threonine-protein kinase TBK1
19	9606.ENSP00000349770	0.614	Interferon regulatory factor 5
20	9606.ENSP00000259089	0.608	Tyrosine-protein kinase Blk

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.995	identical protein binding
GO:0019899	0.995	enzyme binding
GO:0051019	0.969	mitogen-activated protein kinase binding
GO:0140030	0.843	modification-dependent protein binding
GO:0031593	0.763	polyubiquitin modification-dependent protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0050896	0.985	response to stimulus
GO:0009987	0.984	cellular process
GO:0080090	0.981	regulation of primary metabolic process
GO:0043122	0.976	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0009893	0.966	positive regulation of metabolic process
GO:0010604	0.961	positive regulation of macromolecule metabolic process
GO:0043124	0.949	negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051173	0.946	positive regulation of nitrogen compound metabolic process
GO:0071704	0.842	organic substance metabolic process
GO:0048522	0.823	positive regulation of cellular process
GO:1901564	0.822	organonitrogen compound metabolic process
GO:0048584	0.820	positive regulation of response to stimulus
GO:0043170	0.819	macromolecule metabolic process
GO:0031323	0.815	regulation of cellular metabolic process
GO:0010468	0.808	regulation of gene expression
GO:0044238	0.798	primary metabolic process
GO:0019538	0.778	protein metabolic process
GO:0051716	0.774	cellular response to stimulus
GO:0006950	0.717	response to stress
GO:0007165	0.709	signal transduction
GO:0051246	0.675	regulation of protein metabolic process
GO:0044237	0.640	cellular metabolic process
GO:2001141	0.545	regulation of RNA biosynthetic process
GO:0080134	0.529	regulation of response to stress
GO:1903506	0.503	regulation of nucleic acid-templated transcription
GO:0031347	0.482	regulation of defense response
GO:0002684	0.472	positive regulation of immune system process
GO:0006355	0.462	regulation of DNA-templated transcription
GO:0002376	0.451	immune system process
GO:0032101	0.447	regulation of response to external stimulus
GO:0050776	0.445	regulation of immune response
GO:0050778	0.439	positive regulation of immune response
GO:0031325	0.437	positive regulation of cellular metabolic process
GO:0032103	0.400	positive regulation of response to external stimulus
GO:0031349	0.397	positive regulation of defense response
GO:0006952	0.392	defense response
GO:0002253	0.384	activation of immune response
GO:0002764	0.371	immune response-regulating signaling pathway
GO:0002831	0.347	regulation of response to biotic stimulus
GO:0023056	0.346	positive regulation of signaling
GO:0010647	0.346	positive regulation of cell communication
GO:0009967	0.344	positive regulation of signal transduction
GO:0031399	0.343	regulation of protein modification process
GO:0002757	0.301	immune response-activating signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.996	nucleoplasm
GO:0016020	0.364	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]