StarFunc result for job id Q15027

User Input

>input (740 residues)
MTVKLDFEECLKDSPRFRASIELVEAEVSELETRLEKLLKLGTGLLESGRHYLAASRAFV
VGICDLARLGPPEPMMAECLEKFTVSLNHKLDSHAELLDATQHTLQQQIQTLVKEGLRGF
REARRDFWRGAESLEAALTHNAEVPRRRAQEAEEAGAALRTARAGYRGRALDYALQINVI
EDKRKFDIMEFVLRLVEAQATHFQQGHEELSRLSQYRKELGAQLHQLVLNSAREKRDMEQ
RHVLLKQKELGGEEPEPSLREGPGGLVMEGHLFKRASNAFKTWSRRWFTIQSNQLVYQKK
YKDPVTVVVDDLRLCTVKLCPDSERRFCFEVVSTSKSCLLQADSERLLQLWVSAVQSSIA
SAFSQARLDDSPRGPGQGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQC
CDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKVRSLTLDSWEPELVKLMCELGNVI
INQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPRGQP
PVPPKPSIRPRPGSLRSKPEPPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNW
VNGGQDNATPLIQATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFL
KRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKMREAEAAQGQAGDETYLDIFRDFS
LMASDDPEKLSRRSHDLHTL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15027	1.000	1.000	0.000	740	1.000	1.000	Q15027.pdb.gz	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
2	AFDB:Q15057	0.665	0.638	1.131E-66	778	0.542	0.515	Q15057.pdb.gz	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
3	AFDB:Q3UH98	0.631	0.573	8.707E-61	833	0.518	0.460	Q3UH98.pdb.gz	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
4	AFDB:Q9VCQ6	0.578	0.529	6.714E-49	828	0.357	0.319	Q9VCQ6.pdb.gz	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
5	AFDB:Q9XXH8	0.454	0.409	3.190E-43	826	0.315	0.282	Q9XXH8.pdb.gz	CNT1_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 OS=Caenorhabditis elegans OX=6239 GN=cnt-1 PE=1 SV=2
6	AFDB:Q551Q8	0.395	0.351	2.800E-39	843	0.258	0.227	Q551Q8.pdb.gz	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
7	AFDB:Q5W7F2	0.386	0.349	7.688E-35	827	0.261	0.233	Q5W7F2.pdb.gz	AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana OX=3702 GN=AGD3 PE=1 SV=1
8	AFDB:Q9FIT8	0.364	0.329	6.595E-34	828	0.269	0.240	Q9FIT8.pdb.gz	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
9	AFDB:Q54WI0	0.323	0.184	2.805E-33	1333	0.222	0.123	Q54WI0.pdb.gz	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
10	AFDB:O43150	0.346	0.265	5.658E-33	1006	0.211	0.155	O43150.pdb.gz	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
11	PDB:3lvqE	0.313	0.539	5.103E-13	420	0.109	0.193	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
12	PDB:3ljuX	0.148	0.289	4.682E-7	373	0.062	0.123	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:8cs9A	0.157	0.146	2.535E-5	796	0.049	0.045	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:1bd8A	0.153	0.685	4.894E-5	156	0.050	0.237	1bd8A.pdb.gz
15	PDB:3o47A	0.106	0.256	9.874E-5	289	0.047	0.121	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
16	PDB:6jd6B	0.157	0.577	9.874E-5	192	0.042	0.161	6jd6B.pdb.gz
17	PDB:7df7B	0.144	0.857	1.403E-4	119	0.046	0.286	7df7B.pdb.gz
18	PDB:4mt6A	0.127	0.233	2.481E-4	389	0.055	0.105	4mt6A.pdb.gz
19	PDB:1ap7A	0.155	0.613	2.592E-4	168	0.050	0.220	1ap7A.pdb.gz
20	PDB:4oauC	0.156	0.167	2.829E-4	692	0.045	0.048	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ADA6	0.0	570	829	0.397	0.355	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
2	Q15027	0.0	1517	740	1.000	1.000	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
3	Q15057	0.0	775	778	0.545	0.518	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
4	Q3UH98	0.0	564	833	0.397	0.353	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
5	Q4QQN0	0.0	564	626	0.399	0.471	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
6	Q5FVC7	0.0	778	770	0.543	0.522	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
7	Q6NXL5	0.0	565	833	0.399	0.354	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
8	Q6ZQK5	0.0	778	770	0.542	0.521	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
9	Q9VCQ6	2.86e-117	374	828	0.353	0.315	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
10	Q8T0R1	1.11e-112	360	767	0.259	0.250	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
11	Q9XXH8	5.44e-99	326	826	0.328	0.294	CNT1_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 OS=Caenorhabditis elegans OX=6239 GN=cnt-1 PE=1 SV=2
12	Q7KS50	1.49e-73	252	598	0.168	0.207	Q7KS50_DROME Centaurin beta 1A, isoform B OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
13	Q8MSZ5	1.01e-59	203	235	0.141	0.443	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
14	Q54WI0	4.11e-46	180	1333	0.230	0.128	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
15	Q8C8T5	3.31e-44	160	215	0.119	0.409	Q8C8T5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
16	Q8TDY4	9.45e-44	172	903	0.226	0.185	ASAP3_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ASAP3 PE=1 SV=1
17	O43150	1.46e-43	172	1006	0.196	0.144	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
18	Q5W7F2	2.51e-41	164	827	0.223	0.200	AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana OX=3702 GN=AGD3 PE=1 SV=1
19	Q9FIT8	2.89e-41	164	828	0.218	0.194	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
20	Q551Q8	2.91e-39	158	843	0.134	0.117	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	1.4	20.7	Ankyrin repeat
2	PF12796 Ank_2	1.1e-05	37.2	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.026	25.9	Ankyrin repeat
4	PF13637 Ank_4	0.001	30.8	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.4e-06	37.8	Ankyrin repeats (many copies)
6	PF01412 ArfGap	5.9e-35	131.3	Putative GTPase activating protein for Arf
7	PF16746 BAR_3	4.2e-61	218.1	BAR domain of APPL family
8	PF00169 PH	3.5e-11	54.9	PH domain
9	PF15413 PH_11	7.2e+02	12.1	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000158762

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298316	0.985	ADP-ribosylation factor 6
2	9606.ENSP00000320935	0.979	Solute carrier family 2, facilitated glucose transporter member 4
3	9606.ENSP00000386289	0.967	PTB domain-containing engulfment adapter protein 1
4	9606.ENSP00000479606	0.934	Clathrin heavy chain 1
5	9606.ENSP00000263088	0.920	Phospholipase D2
6	9606.ENSP00000342793	0.906	Phospholipase D1
7	9606.ENSP00000000233	0.765	ADP-ribosylation factor 5
8	9606.ENSP00000379350	0.758	Integrin beta-1
9	9606.ENSP00000429015	0.750	Ankyrin repeat domain-containing protein 46
10	9606.ENSP00000267339	0.714	Ankyrin repeat domain-containing protein 10
11	9606.ENSP00000375914	0.714	Rhomboid-related protein 4
12	9606.ENSP00000262305	0.680	Rab11 family-interacting protein 3
13	9606.ENSP00000244040	0.667	Ras-related protein Rab-22A
14	9606.ENSP00000440005	0.667	ADP-ribosylation factor 1
15	9606.ENSP00000272907	0.655	Neuronal tyrosine-phosphorylated phosphoinositide-3-kinase adapter 2
16	9606.ENSP00000369897	0.652	Cysteine--tRNA ligase, cytoplasmic
17	9606.ENSP00000416558	0.651	F-box only protein 24
18	9606.ENSP00000300650	0.649	Ring finger protein 214
19	9606.ENSP00000054666	0.646	Vesicle-associated membrane protein 3
20	9606.ENSP00000020673	0.643	PH and SEC7 domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.898	molecular function regulator activity
GO:0030234	0.856	enzyme regulator activity
GO:0140677	0.734	molecular function activator activity
GO:0030695	0.728	GTPase regulator activity
GO:0005096	0.713	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0009987	0.994	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0051128	0.804	regulation of cellular component organization
GO:0051179	0.397	localization
GO:0032502	0.381	developmental process
GO:0006810	0.348	transport
GO:0048856	0.339	anatomical structure development
GO:0048518	0.328	positive regulation of biological process
GO:0032501	0.313	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0005829	0.932	cytosol
GO:0005886	0.916	plasma membrane
GO:0005634	0.680	nucleus
GO:0070013	0.634	intracellular organelle lumen
GO:0031981	0.524	nuclear lumen
GO:0005654	0.502	nucleoplasm
GO:0012505	0.324	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]