StarFunc result for job id Q15029

User Input

>input (972 residues)
MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLH
EDKKYYPTAEEVYGPEVETIVQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLA
DLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKRYDQDLCYTDILFTEQERGVG
IKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLIL
SPLLGNVCFSSSQYSICFTLGSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKA
PTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELGIHLTKEELKLNIRPLLRLVC
KKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIE
VNRVPAGNWVLIEGVDQPIVKTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSEL
PKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCVMHDLRKMYSEIDIKVADPVV
TFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLC
DELIRNVKFKILDAVVAQEPLHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPA
DCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDSFGFETDLRTHTQGQAFSLSV
FHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3jb9B	0.906	0.973	0.000	904	0.523	0.562	3jb9B.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
2	PDB:7dvqC	0.910	0.980	0.000	902	0.927	0.999	7dvqC.pdb.gz	Structure of the activated human minor spliceosome.
3	AFDB:A8WFS1	0.942	0.941	0.000	973	0.917	0.916	A8WFS1.pdb.gz	A8WFS1_DANRE 116 kDa U5 small nuclear ribonucleoprotein component OS=Danio rerio OX=7955 GN=wu:fi20f05 PE=1 SV=1
4	AFDB:O94316	0.949	0.937	0.000	984	0.550	0.544	O94316.pdb.gz	SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf10 PE=1 SV=2
5	AFDB:Q9LNC5	0.961	0.947	0.000	987	0.619	0.610	Q9LNC5.pdb.gz	CLO_ARATH 110 kDa U5 small nuclear ribonucleoprotein component CLO OS=Arabidopsis thaliana OX=3702 GN=CLO PE=1 SV=1
6	AFDB:Q9VAX8	0.977	0.974	0.000	975	0.753	0.751	Q9VAX8.pdb.gz	Q9VAX8_DROME 116 kDa U5 small nuclear ribonucleoprotein component OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4849 PE=1 SV=1
7	AFDB:P29691	0.801	0.910	4.793E-96	852	0.336	0.384	P29691.pdb.gz	EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans OX=6239 GN=eef-2 PE=1 SV=4
8	AFDB:A0A286Y8X9	0.805	0.905	6.277E-95	860	0.341	0.385	A0A286Y8X9.pdb.gz
9	AFDB:C0H9N2	0.820	0.926	1.505E-94	858	0.337	0.382	C0H9N2.pdb.gz	C0H9N2_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
10	AFDB:P15112	0.794	0.914	3.799E-94	839	0.336	0.390	P15112.pdb.gz	EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=efbA PE=1 SV=2
11	AFDB:O14460	0.803	0.922	1.063E-93	842	0.328	0.379	O14460.pdb.gz	EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eft201 PE=1 SV=2
12	AFDB:P36048	0.875	0.845	3.654E-93	1008	0.337	0.325	P36048.pdb.gz	SN114_YEAST Pre-mRNA-splicing factor SNU114 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNU114 PE=1 SV=1
13	PDB:6j6gC	0.848	0.894	1.384E-84	920	0.326	0.345	6j6gC.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
14	PDB:6d9j9	0.540	0.607	7.627E-75	856	0.347	0.394	6d9j9.pdb.gz	Dual tRNA mimicry in the Cricket Paralysis Virus IRES uncovers an unexpected similarity with the Hepatitis C Virus IRES.
15	PDB:5lj3C	0.805	0.885	1.925E-74	882	0.312	0.344	5lj3C.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
16	PDB:5juoDC	0.547	0.625	1.022E-67	841	0.323	0.373	5juoDC.pdb.gz	Ensemble cryo-EM uncovers inchworm-like translocation of a viral IRES through the ribosome.
17	PDB:3dnyT	0.430	0.620	8.398E-59	654	0.257	0.382	3dnyT.pdb.gz
18	PDB:7nshBC	0.361	0.486	7.911E-39	700	0.169	0.234	7nshBC.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
19	PDB:5anbK	0.667	0.588	9.232E-39	1120	0.264	0.229	5anbK.pdb.gz	Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
20	PDB:7pjvx	0.392	0.522	7.227E-38	703	0.168	0.232	7pjvx.pdb.gz	Structural mechanism of GTPase-powered ribosome-tRNA movement.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A4V7	1963	969	0.986	0.989	A0A8I6A4V7_RAT 116 kDa U5 small nuclear ribonucleoprotein component OS=Rattus norvegicus OX=10116 GN=Eftud2 PE=1 SV=1
2	A0A8I6AI35	1928	937	0.959	0.995	A0A8I6AI35_RAT 116 kDa U5 small nuclear ribonucleoprotein component OS=Rattus norvegicus OX=10116 GN=Eftud2 PE=1 SV=1
3	A8WFS1	1806	973	0.912	0.911	A8WFS1_DANRE 116 kDa U5 small nuclear ribonucleoprotein component OS=Danio rerio OX=7955 GN=wu:fi20f05 PE=1 SV=1
4	B5X1W2	635	858	0.341	0.386	B5X1W2_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
5	C0H9N2	625	858	0.337	0.382	C0H9N2_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
6	C0HAQ6	627	858	0.342	0.387	C0HAQ6_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
7	C0HBD9	634	858	0.340	0.385	C0HBD9_SALSA Elongation factor 2 OS=Salmo salar OX=8030 GN=EF2 PE=2 SV=1
8	F1LM66	1997	972	0.995	0.995	F1LM66_RAT 116 kDa U5 small nuclear ribonucleoprotein component OS=Rattus norvegicus OX=10116 GN=Eftud2 PE=1 SV=3
9	F4JB05	590	820	0.317	0.376	F4JB05_ARATH Ribosomal protein S5/Elongation factor G/III/V family protein OS=Arabidopsis thaliana OX=3702 GN=MGH6.2 PE=4 SV=1
10	F4JWP9	1202	973	0.603	0.602	GFL_ARATH 109 kDa U5 small nuclear ribonucleoprotein component GFL OS=Arabidopsis thaliana OX=3702 GN=GFL PE=2 SV=1
11	O08810	1989	971	0.993	0.994	U5S1_MOUSE 116 kDa U5 small nuclear ribonucleoprotein component OS=Mus musculus OX=10090 GN=Eftud2 PE=1 SV=1
12	O14460	598	842	0.327	0.378	EF2_SCHPO Elongation factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eft201 PE=1 SV=2
13	O94316	1089	984	0.550	0.544	SN114_SCHPO Pre-mRNA-splicing factor cwf10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf10 PE=1 SV=2
14	P05197	636	858	0.351	0.397	EF2_RAT Elongation factor 2 OS=Rattus norvegicus OX=10116 GN=Eef2 PE=1 SV=4
15	P13639	635	858	0.351	0.397	EF2_HUMAN Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4
16	P15112	616	839	0.335	0.389	EF2_DICDI Elongation factor 2 OS=Dictyostelium discoideum OX=44689 GN=efbA PE=1 SV=2
17	P29691	625	852	0.338	0.386	EF2_CAEEL Elongation factor 2 OS=Caenorhabditis elegans OX=6239 GN=eef-2 PE=1 SV=4
18	P32324	609	842	0.322	0.372	EF2_YEAST Elongation factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFT1 PE=1 SV=1
19	P58252	636	858	0.351	0.397	EF2_MOUSE Elongation factor 2 OS=Mus musculus OX=10090 GN=Eef2 PE=1 SV=2
20	Q15029	2004	972	1.000	1.000	U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00679 EFG_C	3.4e-19	80.0	Elongation factor G C-terminus
2	PF14492 EFG_III	0.00013	33.2	Elongation Factor G, domain III
3	PF03764 EFG_IV	1.4e-19	81.5	Elongation factor G, domain IV
4	PF16004 EFTUD2	5.5e-34	128.8	116 kDa U5 small nuclear ribonucleoprotein component N-terminus
5	PF00009 GTP_EFTU	2.1e-42	156.4	Elongation factor Tu GTP binding domain
6	PF03144 GTP_EFTU_D2	3.1e-09	48.4	Elongation factor Tu domain 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006170054.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006152717.1	0.999	Splicing factor 3B subunit 3
2	246437.XP_006166616.1	0.999	U5 small nuclear ribonucleoprotein 200 kDa helicase
3	246437.XP_006167182.1	0.999	pre-mRNA-processing factor 6
4	246437.XP_006167612.1	0.999	Pre-mRNA-processing-splicing factor 8
5	246437.XP_006141760.1	0.998	Intron-binding spliceosomal protein required to link pre-mRNA splicing and snoRNP (small nucleolar ribonucleoprotein) biogenesis. Plays a key role in position-dependent assembly of intron-encoded box C/D small snoRNP, splicing being required for snoRNP assembly. May act by helping the folding of the snoRNA sequence. Binds to intron of pre- mRNAs in a sequence-independent manner, contacting the region between snoRNA and the branchpoint of introns (40 nucleotides upstream of the branchpoint) during the late stages of splicing.
6	246437.XP_006151698.1	0.998	Pre-mRNA-splicing factor CWC22 like protein
7	246437.XP_006158215.1	0.998	U5 small nuclear ribonucleoprotein 40 kDa protein
8	246437.XP_006169687.1	0.998	pre-mRNA-processing factor 19
9	246437.XP_006170290.1	0.998	Pre-mRNA-splicing factor SYF1
10	246437.XP_006144803.1	0.997	U4/U6 small nuclear ribonucleoprotein Prp31
11	246437.XP_006157174.1	0.997	SNW domain-containing protein 1
12	246437.XP_006163692.1	0.997	Crooked neck-like protein 1
13	246437.XP_006142812.1	0.996	pre-mRNA processing factor 4
14	246437.XP_006147981.1	0.996	Splicing factor 3A subunit 1
15	246437.XP_006157051.1	0.996	Pre-mRNA-processing factor 17
16	246437.XP_006157233.1	0.996	Plays role in pre-mRNA splicing as core component of the SMN- Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. As part of the U7 snRNP it is involved in histone pre-mRNA 3'-end processing.
17	246437.XP_006168282.1	0.996	Probable ATP-dependent RNA helicase DDX23
18	246437.XP_006168528.1	0.996	pre-mRNA processing factor 3
19	246437.XP_006170661.1	0.996	Pleiotropic regulator 1
20	246437.XP_006171407.1	0.996	Splicing factor 3B subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0097159	0.995	organic cyclic compound binding
GO:0003676	0.990	nucleic acid binding
GO:0003723	0.899	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0009410	0.895	response to xenobiotic stimulus
GO:1902074	0.853	response to salt
GO:0071704	0.827	organic substance metabolic process
GO:0044237	0.822	cellular metabolic process
GO:0043279	0.822	response to alkaloid
GO:0044238	0.821	primary metabolic process
GO:0043170	0.793	macromolecule metabolic process
GO:0006807	0.791	nitrogen compound metabolic process
GO:0042220	0.742	response to cocaine
GO:0051716	0.622	cellular response to stimulus
GO:0065007	0.607	biological regulation
GO:0070887	0.586	cellular response to chemical stimulus
GO:0071466	0.579	cellular response to xenobiotic stimulus
GO:0050789	0.573	regulation of biological process
GO:0050794	0.443	regulation of cellular process
GO:0010467	0.316	gene expression
GO:0034641	0.305	cellular nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.996	intracellular organelle lumen
GO:0032991	0.994	protein-containing complex
GO:0005737	0.994	cytoplasm
GO:0031981	0.971	nuclear lumen
GO:0005654	0.919	nucleoplasm
GO:1990904	0.904	ribonucleoprotein complex
GO:0005829	0.864	cytosol
GO:0016020	0.858	membrane
GO:1902494	0.672	catalytic complex
GO:0140513	0.379	nuclear protein-containing complex
GO:0005681	0.364	spliceosomal complex
GO:0016604	0.339	nuclear body
GO:0005684	0.334	U2-type spliceosomal complex
GO:0120114	0.325	Sm-like protein family complex
GO:0030532	0.309	small nuclear ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]