StarFunc result for job id Q15031

User Input

>input (903 residues)
MASVWQRLGFYASLLKRQLNGGPDVIKWERRVIPGCTRSIYSATGKWTKEYTLQTRKDVE
KWWHQRIKEQASKISEADKSKPKFYVLSMFPYPSGKLHMGHVRVYTISDTIARFQKMRGM
QVINPMGWDAFGLPAENAAVERNLHPQSWTQSNIKHMRKQLDRLGLCFSWDREITTCLPD
YYKWTQYLFIKLYEAGLAYQKEALVNWDPVDQTVLANEQVDEHGCSWRSGAKVEQKYLRQ
WFIKTTAYAKAMQDALADLPEWYGIKGMQAHWIGDCVGCHLDFTLKVHGQATGEKLTAYT
ATPEAIYGTSHVAISPSHRLLHGHSSLKEALRMALVPGKDCLTPVMAVNMLTQQEVPVVI
LAKADLEGSLDSKIGIPSTSSEDTILAQTLGLAYSEVIETLPDGTERLSSSAEFTGMTRQ
DAFLALTQKARGKRVGGDVTSDKLKDWLISRQRYWGTPIPIVHCPVCGPTPVPLEDLPVT
LPNIASFTGKGGPPLAMASEWVNCSCPRCKGAAKRETDTMDTFVDSAWYYFRYTDPHNPH
SPFNTAVADYWMPVDLYIGGKEHAVMHLFYARFFSHFCHDQKMVKHREPFHKLLAQGLIK
GQTFRLPSGQYLQREEVDLTGSVPVHAKTKEKLEVTWEKMSKSKHNGVDPEEVVEQYGID
TIRLYILFAAPPEKDILWDVKTDALPGVLRWQQRLWTLTTRFIEARASGKSPQPQLLSNK
EKAEARKLWEYKNSVISQVTTHFTEDFSLNSAISQLMGLSNALSQASQSVILHSPEFEDA
LCALMVMAAPLAPHVTSEIWAGLALVPRKLCAHYTWDASVLLQAWPAVDPEFLQQPEVVQ
MAVLINNKACGKIPVPQQVARDQDKVHEFVLQSELGVRLLQGRSIKKSFLSPRTALINFL
VQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15031	1.000	1.000	0.000	903	1.000	1.000	Q15031.pdb.gz	SYLM_HUMAN Leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2
2	AFDB:Q8VDC0	0.971	0.972	0.000	902	0.863	0.864	Q8VDC0.pdb.gz	SYLM_MOUSE Probable leucine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Lars2 PE=1 SV=1
3	AFDB:Q9VZ82	0.778	0.807	2.310E-83	869	0.395	0.411	Q9VZ82.pdb.gz	Q9VZ82_DROME leucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=LeuRS-m PE=1 SV=1
4	AFDB:Q09828	0.696	0.717	3.457E-75	874	0.380	0.392	Q09828.pdb.gz	SYLM_SCHPO Putative leucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G8.09 PE=3 SV=1
5	AFDB:P11325	0.685	0.691	1.492E-73	894	0.351	0.355	P11325.pdb.gz	SYLM_YEAST Leucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM2 PE=1 SV=1
6	AFDB:P07813	0.705	0.736	1.645E-73	860	0.344	0.362	P07813.pdb.gz	SYL_ECOLI Leucine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=leuS PE=1 SV=2
7	AFDB:A0A1D8PQ56	0.678	0.708	1.471E-70	861	0.348	0.365	A0A1D8PQ56.pdb.gz	A0A1D8PQ56_CANAL leucine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NAM2 PE=3 SV=1
8	AFDB:Q9XEA0	0.674	0.631	3.217E-70	973	0.337	0.312	Q9XEA0.pdb.gz	SYLM_ARATH Leucine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB2369 PE=2 SV=1
9	PDB:3zgzD	0.682	0.708	5.024E-69	867	0.346	0.360	3zgzD.pdb.gz	Plant Tumour Biocontrol Agent Employs a tRNA-Dependent Mechanism to Inhibit Leucyl-tRNA Synthetase
10	PDB:4ariA	0.656	0.714	3.470E-63	821	0.321	0.353	4ariA.pdb.gz	Structural Dynamics of the Aminoacylation and Proofreading Functional Cycle of Bacterial Leucyl-tRNA Synthetase
11	AFDB:P9WFV1	0.701	0.658	5.523E-60	969	0.301	0.281	P9WFV1.pdb.gz	SYL_MYCTU Leucine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=leuS PE=1 SV=1
12	AFDB:P9WFS9	0.497	0.506	5.901E-32	886	0.179	0.183	P9WFS9.pdb.gz	SYV_MYCTU Valine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=valS PE=1 SV=2
13	PDB:7d5cA	0.495	0.487	2.526E-26	919	0.146	0.144	7d5cA.pdb.gz	Inhibitory mechanism of reveromycin A at the tRNA binding site of a class I synthetase.
14	PDB:6lpfB	0.412	0.375	6.860E-20	1006	0.157	0.141	6lpfB.pdb.gz	Molecular basis of the multifaceted functions of human leucyl-tRNA synthetase in protein synthesis and beyond.
15	PDB:6ax8A	0.426	0.726	9.571E-18	509	0.116	0.206	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
16	PDB:1u0bB	0.279	0.506	1.156E-5	461	0.085	0.167	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
17	PDB:1li7B	0.270	0.579	3.908E-4	375	0.075	0.181	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
18	PDB:5yymA	0.116	0.170	1.203E-3	581	0.042	0.065	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
19	PDB:5b63C	0.112	0.172	6.994E-3	553	0.039	0.063	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
20	PDB:1f7uA	0.173	0.240	1.953E-2	606	0.051	0.076	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PQ56	0.0	553	861	0.349	0.366	A0A1D8PQ56_CANAL leucine--tRNA ligase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=NAM2 PE=3 SV=1
2	Q09828	0.0	614	874	0.383	0.396	SYLM_SCHPO Putative leucine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G8.09 PE=3 SV=1
3	Q15031	0.0	1884	903	1.000	1.000	SYLM_HUMAN Leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2
4	Q8VDC0	0.0	1654	902	0.865	0.866	SYLM_MOUSE Probable leucine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Lars2 PE=1 SV=1
5	Q9VZ82	0.0	657	869	0.396	0.412	Q9VZ82_DROME leucine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=LeuRS-m PE=1 SV=1
6	P11325	1.75e-179	543	894	0.340	0.343	SYLM_YEAST Leucine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAM2 PE=1 SV=1
7	P07813	3.07e-167	511	860	0.348	0.365	SYL_ECOLI Leucine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=leuS PE=1 SV=2
8	Q9XEA0	1.15e-144	455	973	0.334	0.310	SYLM_ARATH Leucine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB2369 PE=2 SV=1
9	P9WFV1	1.19e-102	343	969	0.298	0.278	SYL_MYCTU Leucine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=leuS PE=1 SV=1
10	Q9U1Q4	6.02e-19	95.1	1050	0.202	0.173	SYV_CAEEL Valine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=glp-4 PE=1 SV=1
11	O27552	2.09e-15	83.6	937	0.055	0.053	SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=leuS PE=1 SV=1
12	P07118	3.30e-14	79.7	951	0.058	0.055	SYV_ECOLI Valine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=valS PE=1 SV=2
13	F4KE63	7.40e-14	78.6	974	0.204	0.189	SYVM2_ARATH Valine--tRNA ligase, chloroplastic/mitochondrial 2 OS=Arabidopsis thaliana OX=3702 GN=EMB2247 PE=3 SV=1
14	P07806	7.51e-14	78.6	1104	0.081	0.066	SYV_YEAST Valine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAS1 PE=1 SV=2
15	Q6FTE7	2.74e-13	76.6	1105	0.118	0.097	Q6FTE7_CANGA valine--tRNA ligase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G03091g PE=3 SV=1
16	O75005	2.98e-13	76.6	980	0.074	0.068	SYV_SCHPO Valine--tRNA ligase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vas2 PE=3 SV=1
17	Q04462	3.06e-13	76.6	1264	0.120	0.085	SYVC_RAT Valine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Vars1 PE=2 SV=2
18	P9WFS9	3.36e-13	76.3	886	0.052	0.053	SYV_MYCTU Valine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=valS PE=1 SV=2
19	A0A024RCN6	3.44e-13	76.3	1264	0.109	0.078	A0A024RCN6_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 PE=1 SV=1
20	P26640	3.44e-13	76.3	1264	0.109	0.078	SYVC_HUMAN Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS1 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08264 Anticodon_1	7.3e-10	50.5	Anticodon-binding domain of tRNA ligase
2	PF00133 tRNA-synt_1	2.3e-41	153.4	tRNA synthetases class I (I, L, M and V)
3	PF01406 tRNA-synt_1e	2.3	19.1	tRNA synthetases class I (C) catalytic domain
4	PF01921 tRNA-synt_1f	8.2	16.8	tRNA synthetases class I (K)
5	PF09334 tRNA-synt_1g	2.9e-26	103.8	tRNA synthetases class I (M)
6	PF13603 tRNA-synt_1_2	5e-05	34.4	Leucyl-tRNA synthetase, Domain 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000408576

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358423	0.988	Ras-related GTP-binding protein D
2	9606.ENSP00000362576	0.981	Tyrosine--tRNA ligase, cytoplasmic
3	9606.ENSP00000360327	0.979	Probable proline--tRNA ligase, mitochondrial
4	9606.ENSP00000320658	0.965	Tyrosine--tRNA ligase, mitochondrial
5	9606.ENSP00000355890	0.958	Bifunctional glutamate/proline--tRNA ligase
6	9606.ENSP00000262027	0.955	Methionine--tRNA ligase, cytoplasmic
7	9606.ENSP00000261772	0.954	Alanine--tRNA ligase, cytoplasmic
8	9606.ENSP00000358549	0.943	Probable arginine--tRNA ligase, mitochondrial
9	9606.ENSP00000307567	0.940	Glutamine--tRNA ligase
10	9606.ENSP00000281038	0.936	Probable asparagine--tRNA ligase, mitochondrial
11	9606.ENSP00000395196	0.928	Probable glutamate--tRNA ligase, mitochondrial
12	9606.ENSP00000273317	0.927	LIM domain-containing protein 1
13	9606.ENSP00000231572	0.925	Arginine--tRNA ligase, cytoplasmic
14	9606.ENSP00000234677	0.925	Serine--tRNA ligase, cytoplasmic
15	9606.ENSP00000472847	0.922	Serine--tRNA ligase, mitochondrial
16	9606.ENSP00000235521	0.921	Tryptophan--tRNA ligase, mitochondrial
17	9606.ENSP00000377954	0.913	Leucine--tRNA ligase, cytoplasmic
18	9606.ENSP00000316335	0.909	Phenylalanine--tRNA ligase, mitochondrial
19	9606.ENSP00000282276	0.908	Methionine--tRNA ligase, mitochondrial
20	9606.ENSP00000369897	0.903	Cysteine--tRNA ligase, cytoplasmic

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004823	0.998	leucine-tRNA ligase activity
GO:0005488	0.946	binding
GO:0005515	0.937	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044281	0.996	small molecule metabolic process
GO:0034660	0.996	ncRNA metabolic process
GO:0006412	0.996	translation
GO:0006418	0.994	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0005759	0.882	mitochondrial matrix
GO:0005829	0.326	cytosol
GO:0031981	0.302	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:11688	0.998	ATP + L-leucine + tRNA(Leu) = AMP + diphosphate + L-leucyl-tRNA(Leu)
EC:6.1.1.4	0.998	leucine--tRNA ligase.

[back to server]