StarFunc result for job id Q15038

User Input

>input (168 residues)
MNSKGQYPTQPTYPVQPPGNPVYPQTLHLPQAPPYTDAPPAYSELYRPSFVHPGAATVPT
MSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPVGPIYPPGSTVLVEGGYDAGARFGAGA
TAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R110	0.419	0.419	1.045E-25	168	1.000	1.000	A0A024R110.pdb.gz
2	AFDB:A0A1L8ER70	0.138	0.081	3.412	331	0.083	0.042	A0A1L8ER70.pdb.gz	HYLS1_XENLA Centriolar and ciliogenesis-associated protein HYLS1 OS=Xenopus laevis OX=8355 GN=hyls-1 PE=1 SV=1
3	AFDB:P19020	0.140	0.063	3.649	446	0.095	0.036	P19020.pdb.gz	DRD3_RAT D(3) dopamine receptor OS=Rattus norvegicus OX=10116 GN=Drd3 PE=1 SV=1
4	PDB:6msjA	0.116	0.056	4.239	413	0.036	0.015	6msjA.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
5	PDB:1q32B	0.109	0.047	4.848	420	0.030	0.012	1q32B.pdb.gz
6	PDB:4f5fB	0.129	0.064	4.848	400	0.065	0.028	4f5fB.pdb.gz
7	PDB:4mqwB	0.107	0.149	4.848	109	0.042	0.064	4mqwB.pdb.gz
8	PDB:5wmlA	0.156	0.071	5.544	404	0.048	0.020	5wmlA.pdb.gz	Structural basis for substrate recognition and inhibition of prephenate aminotransferase from Arabidopsis.
9	AFDB:A0A0G2L5S8	0.108	0.035	5.838	767	0.060	0.013	A0A0G2L5S8.pdb.gz
10	PDB:2jbhB	0.077	0.063	5.929	213	0.042	0.033	2jbhB.pdb.gz	Structural and Functional Studies of the Human Phosphoribosyltransferase Domain Containing Protein 1.
11	AFDB:F1RR02	0.129	0.057	6.243	468	0.077	0.028	F1RR02.pdb.gz	F1RR02_PIG Glial fibrillary acidic protein OS=Sus scrofa OX=9823 GN=GFAP PE=1 SV=3
12	AFDB:Q13952	0.107	0.053	6.243	458	0.089	0.033	Q13952.pdb.gz	NFYC_HUMAN Nuclear transcription factor Y subunit gamma OS=Homo sapiens OX=9606 GN=NFYC PE=1 SV=3
13	AFDB:Q96QE3	0.112	0.017	6.243	1844	0.143	0.013	Q96QE3.pdb.gz	ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4
14	PDB:2oi6B	0.114	0.047	6.341	452	0.024	0.009	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.
15	PDB:6l1lB	0.142	0.065	6.782	393	0.054	0.023	6l1lB.pdb.gz	Structural insights into the catalytic mechanism of Bacillus subtilis BacF.
16	PDB:2o0rA	0.157	0.071	7.252	385	0.048	0.021	2o0rA.pdb.gz	The Three-dimensional Structure of N-Succinyldiaminopimelate Aminotransferase from Mycobacterium tuberculosis
17	PDB:4a2iL	0.088	0.116	7.252	123	0.060	0.081	4a2iL.pdb.gz	Cryo-Electron Microscopy Structure of the 30S Subunit in Complex with the Yjeq Biogenesis Factor.
18	AFDB:Q62880	0.150	0.104	8.166	258	0.101	0.066	Q62880.pdb.gz	TAF9B_RAT Transcription initiation factor TFIID subunit 9B OS=Rattus norvegicus OX=10116 GN=Taf9b PE=2 SV=2
19	AFDB:Q6FUW3	0.148	0.037	8.733	975	0.149	0.026	Q6FUW3.pdb.gz	Q6FUW3_CANGA Candida glabrata strain CBS138 chromosome E complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=EPA3 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15038	8.26e-116	327	168	1.000	1.000	DAZP2_HUMAN DAZ-associated protein 2 OS=Homo sapiens OX=9606 GN=DAZAP2 PE=1 SV=1
2	Q9DCP9	3.44e-115	325	168	0.994	0.994	DAZP2_MOUSE DAZ-associated protein 2 OS=Mus musculus OX=10090 GN=Dazap2 PE=1 SV=1
3	S4R3Q0	9.23e-83	242	134	0.750	0.940	S4R3Q0_HUMAN DAZ-associated protein 2 OS=Homo sapiens OX=9606 GN=DAZAP2 PE=1 SV=1
4	F8VUW5	6.02e-71	211	108	0.643	1.000	F8VUW5_HUMAN DAZ-associated protein 2 OS=Homo sapiens OX=9606 GN=DAZAP2 PE=1 SV=1
5	O69631	0.19	34.3	548	0.161	0.049	O69631_MYCTO Peptide ABC transporter, ATP-binding protein, putative OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3764 PE=4 SV=1
6	A0A0G2K8Z9	0.69	32.7	1815	0.119	0.011	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
7	Q99683	0.91	32.3	1374	0.101	0.012	M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP3K5 PE=1 SV=1
8	O74842	1.2	32.0	1284	0.179	0.023	FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fft2 PE=1 SV=1
9	G5EAY1	2.6	30.8	1474	0.089	0.010	G5EAY1_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=teaA PE=4 SV=1
10	O94466	3.3	30.4	695	0.131	0.032	RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga7 PE=1 SV=1
11	Q91Z79	3.6	30.4	1192	0.149	0.021	LIPA3_RAT Liprin-alpha-3 OS=Rattus norvegicus OX=10116 GN=Ppfia3 PE=1 SV=2
12	P15291	4.0	30.0	398	0.161	0.068	B4GT1_HUMAN Beta-1,4-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=5
13	Q86XA6	5.0	29.6	225	0.161	0.120	Q86XA6_HUMAN B4GALT1 protein OS=Homo sapiens OX=9606 GN=B4GALT1 PE=1 SV=1
14	Q583E0	7.6	29.3	823	0.113	0.023	Q583E0_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.600 PE=4 SV=1
15	Q20605	9.2	28.9	515	0.077	0.025	AMT2_CAEEL Putative ammonium transporter 2 OS=Caenorhabditis elegans OX=6239 GN=amt-2 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11029 DAZAP2	4.3e-40	149.1	DAZ associated protein 2 (DAZAP2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 43179.ENSSTOP00000021290

Rank	PPI partner	STRING score	Description
1	43179.ENSSTOP00000005722	0.692	DAZ associated protein 1
2	43179.ENSSTOP00000009952	0.656	SLAIN motif family, member 1
3	43179.ENSSTOP00000020028	0.646	Deleted in azoospermia-like
4	43179.ENSSTOP00000010694	0.572	Bora, aurora kinase A activator
5	43179.ENSSTOP00000003245	0.519	Importin 13
6	43179.ENSSTOP00000006779	0.502	NOP2 nucleolar protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	0.999	protein kinase binding
GO:1901363	0.451	heterocyclic compound binding
GO:0097159	0.451	organic cyclic compound binding
GO:0003676	0.403	nucleic acid binding
GO:0003824	0.347	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0060255	0.981	regulation of macromolecule metabolic process
GO:0050794	0.980	regulation of cellular process
GO:0009987	0.976	cellular process
GO:0065009	0.972	regulation of molecular function
GO:0048522	0.962	positive regulation of cellular process
GO:0051247	0.961	positive regulation of protein metabolic process
GO:0031325	0.947	positive regulation of cellular metabolic process
GO:0001932	0.940	regulation of protein phosphorylation
GO:0051338	0.924	regulation of transferase activity
GO:0071840	0.921	cellular component organization or biogenesis
GO:0043549	0.911	regulation of kinase activity
GO:0045859	0.896	regulation of protein kinase activity
GO:0051347	0.893	positive regulation of transferase activity
GO:0033674	0.869	positive regulation of kinase activity
GO:0006996	0.847	organelle organization
GO:0065008	0.828	regulation of biological quality
GO:0045860	0.816	positive regulation of protein kinase activity
GO:0051101	0.791	regulation of DNA binding
GO:0070925	0.716	organelle assembly
GO:0034063	0.712	stress granule assembly
GO:2000677	0.709	regulation of transcription regulatory region DNA binding
GO:0031647	0.696	regulation of protein stability
GO:0051099	0.676	positive regulation of binding
GO:0031648	0.630	protein destabilization
GO:0071900	0.483	regulation of protein serine/threonine kinase activity
GO:0043388	0.462	positive regulation of DNA binding
GO:0019219	0.337	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.995	protein-containing complex
GO:0016604	0.981	nuclear body
GO:0016607	0.961	nuclear speck
GO:0005737	0.955	cytoplasm
GO:0043232	0.927	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]