StarFunc result for job id Q15041

User Input

>input (203 residues)
MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIY
YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV
GWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGII
LKYIGMAKREINKLLKQKEKKNE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15041	1.000	1.000	9.389E-28	203	1.000	1.000	Q15041.pdb.gz	AR6P1_HUMAN ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Homo sapiens OX=9606 GN=ARL6IP1 PE=1 SV=2
2	AFDB:Q7ZWB4	0.974	0.974	6.506E-24	203	0.783	0.783	Q7ZWB4.pdb.gz	Q7ZWB4_DANRE ADP-ribosylation factor-like 6 interacting protein OS=Danio rerio OX=7955 GN=arl6ip PE=1 SV=1
3	AFDB:Q9VES1	0.870	0.894	5.055E-11	197	0.276	0.284	Q9VES1.pdb.gz	AR6P1_DROME ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=Arl6IP1 PE=2 SV=1
4	AFDB:Q6NS82	0.710	0.291	1.678E-5	541	0.202	0.076	Q6NS82.pdb.gz	RETR2_MOUSE Reticulophagy regulator 2 OS=Mus musculus OX=10090 GN=Retreg2 PE=1 SV=2
5	AFDB:Q8NC44	0.715	0.288	2.018E-4	543	0.202	0.076	Q8NC44.pdb.gz	RETR2_HUMAN Reticulophagy regulator 2 OS=Homo sapiens OX=9606 GN=RETREG2 PE=1 SV=3
6	AFDB:Q86VR2	0.758	0.358	4.140E-4	466	0.163	0.071	Q86VR2.pdb.gz	RETR3_HUMAN Reticulophagy regulator 3 OS=Homo sapiens OX=9606 GN=RETREG3 PE=1 SV=1
7	AFDB:Q9FFS0	0.375	0.313	2.865E-3	257	0.153	0.121	Q9FFS0.pdb.gz	RTNLD_ARATH Reticulon-like protein B4 OS=Arabidopsis thaliana OX=3702 GN=RTNLB4 PE=1 SV=1
8	AFDB:Q585Y2	0.398	0.426	1.141E-2	186	0.167	0.183	Q585Y2.pdb.gz	Q585Y2_TRYB2 Reticulon-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.620 PE=4 SV=1
9	AFDB:Q9SUT9	0.326	0.265	1.590E-2	271	0.128	0.096	Q9SUT9.pdb.gz	RTNLB_ARATH Reticulon-like protein B2 OS=Arabidopsis thaliana OX=3702 GN=RTNLB2 PE=1 SV=1
10	AFDB:Q6DBN4	0.284	0.240	2.474E-2	253	0.138	0.111	Q6DBN4.pdb.gz	RTNLF_ARATH Reticulon-like protein B6 OS=Arabidopsis thaliana OX=3702 GN=RTNLB6 PE=1 SV=1
11	PDB:4ke2A	0.172	0.178	3.563	196	0.079	0.082	4ke2A.pdb.gz
12	PDB:7nb6A	0.137	0.100	3.979	340	0.123	0.074	7nb6A.pdb.gz
13	PDB:6tpiA	0.162	0.099	4.445	380	0.153	0.082	6tpiA.pdb.gz
14	PDB:6lo8F	0.144	0.323	4.697	84	0.069	0.167	6lo8F.pdb.gz
15	PDB:6q0xA	0.166	0.101	4.964	373	0.138	0.075	6q0xA.pdb.gz
16	PDB:5l4kT	0.161	0.129	5.859	272	0.113	0.085	5l4kT.pdb.gz
17	PDB:6sueA	0.115	0.021	5.859	2292	0.138	0.012	6sueA.pdb.gz
18	PDB:7d6dA	0.127	0.084	5.859	380	0.133	0.071	7d6dA.pdb.gz
19	PDB:7mqaSP	0.168	0.025	5.859	2485	0.143	0.012	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:5u1dA	0.143	0.074	7.724	561	0.133	0.048	5u1dA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15041	4.55e-151	419	203	1.000	1.000	AR6P1_HUMAN ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Homo sapiens OX=9606 GN=ARL6IP1 PE=1 SV=2
2	Q9JKW0	8.48e-147	408	203	0.966	0.966	AR6P1_MOUSE ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Mus musculus OX=10090 GN=Arl6ip1 PE=1 SV=1
3	Q7ZWB4	2.46e-122	346	203	0.783	0.783	Q7ZWB4_DANRE ADP-ribosylation factor-like 6 interacting protein OS=Danio rerio OX=7955 GN=arl6ip PE=1 SV=1
4	Q9VES1	1.01e-18	82.0	197	0.261	0.269	AR6P1_DROME ADP-ribosylation factor-like protein 6-interacting protein 1 OS=Drosophila melanogaster OX=7227 GN=Arl6IP1 PE=2 SV=1
5	Q8WMU5	1.4	32.0	712	0.094	0.027	FZD6_CANLF Frizzled-6 OS=Canis lupus familiaris OX=9615 GN=FZD6 PE=2 SV=1
6	Q8NC44	1.7	32.0	543	0.197	0.074	RETR2_HUMAN Reticulophagy regulator 2 OS=Homo sapiens OX=9606 GN=RETREG2 PE=1 SV=3
7	O60353	2.7	31.2	706	0.118	0.034	FZD6_HUMAN Frizzled-6 OS=Homo sapiens OX=9606 GN=FZD6 PE=1 SV=2
8	A0A0G2K715	2.8	31.2	2479	0.108	0.009	A0A0G2K715_RAT Centrosomal protein 290 OS=Rattus norvegicus OX=10116 GN=Cep290 PE=4 SV=1
9	A0A8I5ZYJ8	2.9	31.2	2503	0.108	0.009	A0A8I5ZYJ8_RAT Centrosomal protein 290 OS=Rattus norvegicus OX=10116 GN=Cep290 PE=4 SV=1
10	A0A0G2K929	3.5	31.2	2756	0.108	0.008	A0A0G2K929_RAT Centrosomal protein 290 OS=Rattus norvegicus OX=10116 GN=Cep290 PE=4 SV=1
11	Q6NS82	9.6	29.6	541	0.192	0.072	RETR2_MOUSE Reticulophagy regulator 2 OS=Mus musculus OX=10090 GN=Retreg2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04714 BCL_N	1.8e+02	13.6	BCL7, N-terminal conserver region
2	PF02453 Reticulon	0.24	22.8	Reticulon
3	PF07916 TraG_N	1.1e+02	13.2	TraG-like protein, N-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 27679.XP_010337662.1

Rank	PPI partner	STRING score	Description
1	27679.XP_003928381.1	0.701	Belongs to the small GTPase superfamily. Arf family.
2	27679.XP_003939514.1	0.697	PRA1 family protein 3
3	27679.XP_003920810.1	0.658	lysM and putative peptidoglycan-binding domain-containing protein 3
4	27679.XP_010342119.1	0.635	LSM8 homolog, U6 small nuclear RNA associated
5	27679.XP_010331898.1	0.584	Reticulon-4 isoform X1
6	27679.XP_010328666.1	0.581	Receptor expression-enhancing protein 1 isoform X1
7	27679.XP_010344484.1	0.570	Involved in maintaining the homeostasis of cellular nucleotides by catalyzing the interconversion of nucleoside phosphates. Has GTP:AMP phosphotransferase and ITP:AMP phosphotransferase activities
8	27679.XP_003929654.1	0.567	GAS2-like protein 3
9	27679.XP_003921178.1	0.551	Leucine-rich repeat-containing protein 17
10	27679.XP_003933989.1	0.544	Receptor expression-enhancing protein 2 isoform X1
11	27679.XP_003929581.1	0.540	Rap1 GTPase-GDP dissociation stimulator 1 isoform X1
12	27679.XP_003933820.1	0.527	Radial spoke head protein 3 homolog
13	27679.XP_010339920.1	0.527	Tctex1 domain-containing protein 2
14	27679.XP_003930585.1	0.512	Atlastin-1 isoform X1
15	27679.XP_003940295.1	0.504	Reticulon-2
16	27679.XP_003929381.1	0.503	Belongs to the 14-3-3 family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.736	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0051179	0.863	localization
GO:0051641	0.847	cellular localization
GO:0045184	0.837	establishment of protein localization
GO:0010256	0.822	endomembrane system organization
GO:0019222	0.814	regulation of metabolic process
GO:0006810	0.802	transport
GO:0048518	0.794	positive regulation of biological process
GO:0072657	0.788	protein localization to membrane
GO:0006996	0.751	organelle organization
GO:0080090	0.740	regulation of primary metabolic process
GO:0060255	0.727	regulation of macromolecule metabolic process
GO:0051952	0.722	regulation of amine transport
GO:0032890	0.721	regulation of organic acid transport
GO:0051171	0.719	regulation of nitrogen compound metabolic process
GO:0048519	0.708	negative regulation of biological process
GO:0090150	0.661	establishment of protein localization to membrane
GO:0061024	0.642	membrane organization
GO:0051246	0.639	regulation of protein metabolic process
GO:0071705	0.635	nitrogen compound transport
GO:0048523	0.602	negative regulation of cellular process
GO:0007029	0.584	endoplasmic reticulum organization
GO:0051248	0.578	negative regulation of protein metabolic process
GO:2000116	0.521	regulation of cysteine-type endopeptidase activity
GO:0006605	0.508	protein targeting
GO:2000117	0.477	negative regulation of cysteine-type endopeptidase activity
GO:0043281	0.463	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0010941	0.421	regulation of cell death
GO:0051050	0.405	positive regulation of transport
GO:0042981	0.393	regulation of apoptotic process
GO:0043154	0.356	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051128	0.315	regulation of cellular component organization
GO:0048522	0.312	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	1.000	endoplasmic reticulum membrane
GO:0005829	0.994	cytosol
GO:0032991	0.982	protein-containing complex
GO:0071782	0.681	endoplasmic reticulum tubular network
GO:0098588	0.531	bounding membrane of organelle
GO:0098796	0.499	membrane protein complex
GO:0043233	0.371	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]