StarFunc result for job id Q15042

User Input

>input (981 residues)
MAADSEPESEVFEITDFTTASEWERFISKVEEVLNDWKLIGNSLGKPLEKGIFTSGTWEE
KSDEISFADFKFSVTHHYLVQESTDKEGKDELLEDVVPQSMQDLLGMNNDFPPRAHCLVR
WYGLREFVVIAPAAHSDAVLSESKCNLLLSSVSIALGNTGCQVPLFVQIHHKWRRMYVGE
CQGPGVRTDFEMVHLRKVPNQYTHLSGLLDIFKSKIGCPLTPLPPVSIAIRFTYVLQDWQ
QYFWPQQPPDIDALVGGEVGGLEFGKLPFGACEDPISELHLATTWPHLTEGIIVDNDVYS
DLDPIQAPHWSVRVRKAENPQCLLGDFVTEFFKICRRKESTDEILGRSAFEEEGKETADI
THALSKLTEPASVPIHKLSVSNMVHTAKKKIRKHRGVEESPLNNDVLNTILLFLFPDAVS
EKPLDGTTSTDNNNPPSESEDYNLYNQFKSAPSDSLTYKLALCLCMINFYHGGLKGVAHL
WQEFVLEMRFRWENNFLIPGLASGPPDLRCCLLHQKLQMLNCCIERKKARDEGKKTSASD
VTNIYPGDAGKAGDQLVPDNLKETDKEKGEVGKSWDSWSDSEEEFFECLSDTEELKGNGQ
ESGKKGGPKEMANLRPEGRLYQHGKLTLLHNGEPLYIPVTQEPAPMTEDLLEEQSEVLAK
LGTSAEGAHLRARMQSACLLSDMESFKAANPGCSLEDFVRWYSPRDYIEEEVIDEKGNVV
LKGELSARMKIPSNMWVEAWETAKPIPARRQRRLFDDTREAEKVLHYLAIQKPADLARHL
LPCVIHAAVLKVKEEESLENISSVKKIIKQIISHSSKVLHFPNPEDKKLEEIIHQITNVE
ALIARARSLKAKFGTEKCEQEEEKEDLERFVSCLLEQPEVLVTGAGRGHAGRIIHKLFVN
AQRAAAMTPPEEELKRMGSPEERRQNSVSDFPPPAGREFILRTTVPRPAPYSKALPQRMY
SVLTKEDFRLAGAFSSDTSFF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15042	1.000	1.000	0.000	981	1.000	1.000	Q15042.pdb.gz	RB3GP_HUMAN Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3
2	AFDB:Q9VQ26	0.723	0.769	6.872E-60	916	0.277	0.297	Q9VQ26.pdb.gz	RB3GP_DROME Rab3 GTPase-activating protein catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Rab3GAP1 PE=1 SV=2
3	AFDB:Q93538	0.612	0.649	1.017E-50	915	0.224	0.240	Q93538.pdb.gz	RB3GP_CAEEL Rab3 GTPase-activating protein catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=rbg-1 PE=3 SV=1
4	AFDB:Q8RWW8	0.367	0.372	1.777E-47	963	0.245	0.249	Q8RWW8.pdb.gz	Q8RWW8_ARATH Rab3 GTPase-activating protein catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=MQJ2.13 PE=1 SV=1
5	PDB:7qpgB	0.231	0.344	5.902E-5	591	0.086	0.142	7qpgB.pdb.gz
6	AFDB:Q86U86	0.053	0.040	5.771E-1	1689	0.071	0.041	Q86U86.pdb.gz	PB1_HUMAN Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1 PE=1 SV=1
7	AFDB:Q09748	0.042	0.049	7.321E-1	781	0.081	0.101	Q09748.pdb.gz	DNM1_SCHPO Dynamin-related protein dnm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dnm1 PE=3 SV=1
8	AFDB:Q5SPW0	0.060	0.060	1.295	977	0.063	0.063	Q5SPW0.pdb.gz	VPS54_MOUSE Vacuolar protein sorting-associated protein 54 OS=Mus musculus OX=10090 GN=Vps54 PE=1 SV=1
9	PDB:3bcyA	0.037	0.180	1.346	146	0.004	0.027	3bcyA.pdb.gz
10	AFDB:Q6P5F6	0.070	0.080	1.358	833	0.052	0.061	Q6P5F6.pdb.gz	S39AA_MOUSE Zinc transporter ZIP10 OS=Mus musculus OX=10090 GN=Slc39a10 PE=1 SV=1
11	AFDB:Q8L840	0.046	0.040	1.358	1188	0.060	0.050	Q8L840.pdb.gz	RQL4A_ARATH ATP-dependent DNA helicase Q-like 4A OS=Arabidopsis thaliana OX=3702 GN=RECQL4A PE=2 SV=1
12	PDB:1gerB	0.039	0.082	1.411	449	0.009	0.020	1gerB.pdb.gz	Structure of glutathione reductase from Escherichia coli at 1.86 A resolution: comparison with the enzyme from human erythrocytes.
13	PDB:2hqmA	0.035	0.064	1.627	461	0.016	0.035	2hqmA.pdb.gz	Crystal structure of glutathione reductase Glr1 from the yeast Saccharomyces cerevisiae.
14	PDB:3t24A	0.029	0.061	1.627	377	0.008	0.021	3t24A.pdb.gz	Substrate Specificity within a Family of Outer Membrane Carboxylate Channels.
15	PDB:6i7sG	0.064	0.069	1.707	863	0.088	0.100	6i7sG.pdb.gz	The crystal structure of human microsomal triglyceride transfer protein.
16	AFDB:Q6K762	0.056	0.079	1.807	586	0.053	0.089	Q6K762.pdb.gz	PUB73_ORYSJ U-box domain-containing protein 73 OS=Oryza sativa subsp. japonica OX=39947 GN=PUB73 PE=2 SV=1
17	PDB:4k00A	0.030	0.159	1.877	137	0.005	0.036	4k00A.pdb.gz
18	PDB:5l2pA	0.057	0.154	1.968	306	0.021	0.069	5l2pA.pdb.gz
19	PDB:5s9mA	0.036	0.043	2.381	809	0.007	0.009	5s9mA.pdb.gz	Crystal Structure of a rat Autotaxin complex
20	PDB:2odjB	0.033	0.071	2.618	388	0.010	0.026	2odjB.pdb.gz	Structural insight into OprD substrate specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P69735	0.0	1424	775	0.719	0.910	RB3GP_RAT Rab3 GTPase-activating protein catalytic subunit (Fragments) OS=Rattus norvegicus OX=10116 GN=Rab3gap1 PE=1 SV=2
2	Q15042	0.0	2031	981	1.000	1.000	RB3GP_HUMAN Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3
3	Q80UJ7	0.0	1859	981	0.931	0.931	RB3GP_MOUSE Rab3 GTPase-activating protein catalytic subunit OS=Mus musculus OX=10090 GN=Rab3gap1 PE=1 SV=4
4	Q9VQ26	2.43e-106	354	916	0.274	0.294	RB3GP_DROME Rab3 GTPase-activating protein catalytic subunit OS=Drosophila melanogaster OX=7227 GN=Rab3GAP1 PE=1 SV=2
5	Q93538	2.51e-55	209	915	0.214	0.230	RB3GP_CAEEL Rab3 GTPase-activating protein catalytic subunit OS=Caenorhabditis elegans OX=6239 GN=rbg-1 PE=3 SV=1
6	Q8RWW8	5.02e-36	150	963	0.124	0.127	Q8RWW8_ARATH Rab3 GTPase-activating protein catalytic subunit OS=Arabidopsis thaliana OX=3702 GN=MQJ2.13 PE=1 SV=1
7	P38236	0.15	38.1	366	0.043	0.115	FL2D_YEAST Protein MUM2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MUM2 PE=1 SV=1
8	P42208	4.7	33.1	361	0.024	0.066	SEPT2_MOUSE Septin-2 OS=Mus musculus OX=10090 GN=Septin2 PE=1 SV=2
9	Q91Y81	5.4	33.1	361	0.024	0.066	SEPT2_RAT Septin-2 OS=Rattus norvegicus OX=10116 GN=Septin2 PE=1 SV=1
10	Q383F6	8.2	33.1	4242	0.030	0.007	Q383F6_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3010 PE=4 SV=1
11	Q6IWH7	9.7	32.7	933	0.027	0.028	ANO7_HUMAN Anoctamin-7 OS=Homo sapiens OX=9606 GN=ANO7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19533 Rab3-GAP_cat_C	6.8e-109	373.7	Rab3 GTPase-activating protein catalytic subunit C-terminal
2	PF13890 Rab3-GTPase_cat	1.8e-60	214.8	Rab3 GTPase-activating protein catalytic subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411418

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351832	0.999	Rab3 GTPase-activating protein non-catalytic subunit
2	9606.ENSP00000478479	0.960	Ras-related protein Rab-18
3	9606.ENSP00000417175	0.947	Vesicle-associated membrane protein-associated protein B/C
4	9606.ENSP00000350386	0.943	Rab proteins geranylgeranyltransferase component A 1
5	9606.ENSP00000355511	0.932	Rab proteins geranylgeranyltransferase component A 2
6	9606.ENSP00000394071	0.932	Rab GDP dissociation inhibitor alpha
7	9606.ENSP00000369538	0.926	Rab GDP dissociation inhibitor beta
8	9606.ENSP00000311449	0.920	Ras-related protein Rab-6A
9	9606.ENSP00000348965	0.911	Cytoplasmic dynein 1 heavy chain 1
10	9606.ENSP00000254286	0.906	Actin related protein 10 homolog
11	9606.ENSP00000354791	0.905	Dynactin subunit 1
12	9606.ENSP00000358921	0.904	Alpha-centractin
13	9606.ENSP00000414906	0.904	Dynactin subunit 4
14	9606.ENSP00000285208	0.903	Ras-related protein Rab-6B
15	9606.ENSP00000380308	0.903	Cytoplasmic dynein 1 intermediate chain 2
16	9606.ENSP00000408910	0.903	Dynactin subunit 2
17	9606.ENSP00000251047	0.902	Protein ERGIC-53
18	9606.ENSP00000263168	0.902	F-actin-capping protein subunit alpha-1
19	9606.ENSP00000401010	0.902	F-actin-capping protein subunit beta
20	9606.ENSP00000258198	0.901	Cytoplasmic dynein 1 light intermediate chain 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	1.000	small GTPase binding
GO:0005096	1.000	GTPase activator activity
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0065007	0.973	biological regulation
GO:0050789	0.964	regulation of biological process
GO:0050794	0.954	regulation of cellular process
GO:0048518	0.867	positive regulation of biological process
GO:0071840	0.754	cellular component organization or biogenesis
GO:0051128	0.731	regulation of cellular component organization
GO:0051179	0.712	localization
GO:0051234	0.704	establishment of localization
GO:0016043	0.690	cellular component organization
GO:0048522	0.690	positive regulation of cellular process
GO:0051641	0.672	cellular localization
GO:0032501	0.572	multicellular organismal process
GO:0006996	0.524	organelle organization
GO:0019222	0.464	regulation of metabolic process
GO:0044087	0.342	regulation of cellular component biogenesis
GO:0060255	0.333	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005829	0.997	cytosol
GO:0032991	0.996	protein-containing complex
GO:0016020	0.996	membrane
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005576	0.984	extracellular region
GO:0031090	0.969	organelle membrane
GO:0031982	0.968	vesicle
GO:0070062	0.949	extracellular exosome
GO:0005794	0.942	Golgi apparatus
GO:0005783	0.918	endoplasmic reticulum
GO:0031984	0.743	organelle subcompartment
GO:0098827	0.719	endoplasmic reticulum subcompartment
GO:0005789	0.696	endoplasmic reticulum membrane
GO:0098588	0.578	bounding membrane of organelle
GO:0070013	0.427	intracellular organelle lumen
GO:0031410	0.393	cytoplasmic vesicle
GO:0005634	0.370	nucleus
GO:0071782	0.345	endoplasmic reticulum tubular network
GO:0005811	0.324	lipid droplet
GO:0005654	0.310	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]