StarFunc result for job id Q15046

User Input

>input (597 residues)
MAAVQAAEVKVDGSEPKLSKNELKRRLKAEKKVAEKEAKQKELSEKQLSQATAAATNHTT
DNGVGPEEESVDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDH
LTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGD
IIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFV
RQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAP
ELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSG
MVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETR
KILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKE
GLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYG
LPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15046	1.000	1.000	0.000	597	1.000	1.000	Q15046.pdb.gz	SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3
2	AFDB:Q5XIM7	0.955	0.911	0.000	626	0.901	0.859	Q5XIM7.pdb.gz	SYK_RAT Lysine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Kars1 PE=1 SV=1
3	PDB:6chdA	0.839	0.989	9.128E-100	506	0.848	1.000	6chdA.pdb.gz	Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine
4	AFDB:Q9W327	0.856	0.842	1.399E-91	607	0.662	0.651	Q9W327.pdb.gz	Q9W327_DROME Lysine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=LysRS PE=1 SV=2
5	AFDB:Q22099	0.850	0.887	4.461E-85	572	0.573	0.598	Q22099.pdb.gz	SYK_CAEEL Lysine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=kars-1 PE=3 SV=1
6	AFDB:Q9ZPI1	0.855	0.816	2.297E-82	626	0.561	0.535	Q9ZPI1.pdb.gz	SYKC_ARATH Lysine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At3g11710 PE=1 SV=1
7	AFDB:P15180	0.849	0.857	3.847E-81	591	0.528	0.533	P15180.pdb.gz	SYKC_YEAST Lysine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRS1 PE=1 SV=2
8	AFDB:Q54TY4	0.863	0.934	9.660E-79	551	0.516	0.559	Q54TY4.pdb.gz	Q54TY4_DICDI Lysine--tRNA ligase OS=Dictyostelium discoideum OX=44689 GN=lysS PE=3 SV=1
9	AFDB:Q8IDJ8	0.848	0.869	4.975E-76	583	0.482	0.494	Q8IDJ8.pdb.gz	Q8IDJ8_PLAF7 Lysine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1350100 PE=1 SV=1
10	AFDB:Q580G3	0.823	0.841	3.440E-72	584	0.479	0.490	Q580G3.pdb.gz	Q580G3_TRYB2 Lysine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O9.340 PE=3 SV=1
11	AFDB:P0A8N5	0.776	0.913	3.497E-59	505	0.372	0.440	P0A8N5.pdb.gz	SYK2_ECOLI Lysine--tRNA ligase, heat inducible OS=Escherichia coli (strain K12) OX=83333 GN=lysU PE=1 SV=2
12	PDB:1e1tA	0.747	0.913	8.902E-56	485	0.369	0.454	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
13	PDB:1bbuA	0.771	0.942	1.464E-55	486	0.357	0.438	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
14	PDB:5w25A	0.571	0.584	4.166E-28	583	0.183	0.187	5w25A.pdb.gz	Crystal structure of Aspartyl-tRNA synthetase from Mycobacterium tuberculosis complexed with L-Aspartic Acid
15	PDB:1eqrA	0.560	0.567	2.186E-27	590	0.186	0.188	1eqrA.pdb.gz
16	PDB:4ah6A	0.546	0.553	7.369E-24	589	0.176	0.178	4ah6A.pdb.gz
17	PDB:3a5zC	0.451	0.801	2.106E-23	324	0.151	0.278	3a5zC.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
18	PDB:4j15A	0.515	0.697	2.933E-23	431	0.157	0.218	4j15A.pdb.gz
19	PDB:5zg8A	0.520	0.713	2.933E-23	422	0.142	0.201	5zg8A.pdb.gz
20	PDB:3a5yA	0.436	0.850	6.844E-22	297	0.142	0.286	3a5yA.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15180	0.0	658	591	0.526	0.531	SYKC_YEAST Lysine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRS1 PE=1 SV=2
2	P37879	0.0	1161	597	0.938	0.938	SYK_CRIGR Lysine--tRNA ligase OS=Cricetulus griseus OX=10029 GN=KARS1 PE=1 SV=1
3	Q15046	0.0	1244	597	1.000	1.000	SYK_HUMAN Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS1 PE=1 SV=3
4	Q22099	0.0	727	572	0.576	0.601	SYK_CAEEL Lysine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=kars-1 PE=3 SV=1
5	Q54TY4	0.0	642	551	0.506	0.548	Q54TY4_DICDI Lysine--tRNA ligase OS=Dictyostelium discoideum OX=44689 GN=lysS PE=3 SV=1
6	Q580G3	0.0	567	584	0.474	0.485	Q580G3_TRYB2 Lysine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O9.340 PE=3 SV=1
7	Q5XIM7	0.0	1109	626	0.889	0.848	SYK_RAT Lysine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Kars1 PE=1 SV=1
8	Q8IDJ8	0.0	580	583	0.469	0.480	Q8IDJ8_PLAF7 Lysine--tRNA ligase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1350100 PE=1 SV=1
9	Q8SXM8	0.0	815	574	0.660	0.686	Q8SXM8_DROME Lysine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=LysRS PE=1 SV=1
10	Q99MN1	0.0	1158	595	0.926	0.929	SYK_MOUSE Lysine--tRNA ligase OS=Mus musculus OX=10090 GN=Kars1 PE=1 SV=1
11	Q9W327	0.0	810	607	0.631	0.621	Q9W327_DROME Lysine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=LysRS PE=1 SV=2
12	Q9ZPI1	0.0	669	626	0.568	0.542	SYKC_ARATH Lysine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At3g11710 PE=1 SV=1
13	P0A8N5	9.72e-138	412	505	0.382	0.451	SYK2_ECOLI Lysine--tRNA ligase, heat inducible OS=Escherichia coli (strain K12) OX=83333 GN=lysU PE=1 SV=2
14	P0A8N3	1.19e-130	394	505	0.375	0.444	SYK1_ECOLI Lysine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=lysS PE=1 SV=2
15	Q97RS9	6.59e-127	384	496	0.358	0.431	SYK_STRPN Lysine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lysS PE=1 SV=2
16	Q9LJE2	2.41e-112	350	602	0.340	0.337	SYKM_ARATH Lysine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=OVA5 PE=2 SV=1
17	O74858	7.68e-103	323	531	0.322	0.362	SYKM_SCHPO Lysine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msk1 PE=3 SV=1
18	P9WFU7	9.50e-86	291	1172	0.312	0.159	LYSX_MYCTU Lysylphosphatidylglycerol biosynthesis bifunctional protein LysX OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lysX PE=1 SV=1
19	P32048	3.57e-63	220	576	0.275	0.285	SYKM_YEAST Lysine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSK1 PE=1 SV=3
20	P0A8N7	2.77e-31	126	325	0.154	0.283	EPMA_ECOLI Elongation factor P--(R)-beta-lysine ligase OS=Escherichia coli (strain K12) OX=83333 GN=epmA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04624 Dec-1	3.2e+02	12.6	Dec-1 repeat
2	PF00152 tRNA-synt_2	3.4e-78	274.5	tRNA synthetases class II (D, K and N)
3	PF01409 tRNA-synt_2d	0.00031	31.9	tRNA synthetases class II core domain (F)
4	PF01336 tRNA_anti-codon	8.4e-11	53.0	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015876

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017139	0.999	glutamyl-prolyl-tRNA synthetase
2	61853.ENSNLEP00000021027	0.999	methionyl-tRNA synthetase
3	61853.ENSNLEP00000001155	0.998	Aminoacyl tRNA synthetase complex-interacting multifunctional protein 2
4	61853.ENSNLEP00000005925	0.998	arginyl-tRNA synthetase
5	61853.ENSNLEP00000008256	0.997	glutaminyl-tRNA synthetase
6	61853.ENSNLEP00000019833	0.996	isoleucyl-tRNA synthetase
7	61853.ENSNLEP00000012036	0.995	leucyl-tRNA synthetase
8	61853.ENSNLEP00000010808	0.993	aspartyl-tRNA synthetase
9	61853.ENSNLEP00000015820	0.993	Aminoacyl tRNA synthetase complex-interacting multifunctional protein 1
10	61853.ENSNLEP00000014237	0.990	Uncharacterized protein
11	61853.ENSNLEP00000003654	0.989	Tyrosine--tRNA ligase
12	61853.ENSNLEP00000004513	0.955	Eukaryotic translation elongation factor 1 gamma
13	61853.ENSNLEP00000009876	0.946	asparaginyl-tRNA synthetase
14	61853.ENSNLEP00000011462	0.944	histidyl-tRNA synthetase
15	61853.ENSNLEP00000011488	0.916	histidyl-tRNA synthetase 2, mitochondrial
16	61853.ENSNLEP00000015757	0.905	arginyl-tRNA synthetase 2, mitochondrial
17	61853.ENSNLEP00000003679	0.904	prolyl-tRNA synthetase 2, mitochondrial (putative)
18	61853.ENSNLEP00000007327	0.901	leucyl-tRNA synthetase 2, mitochondrial
19	61853.ENSNLEP00000007738	0.901	valyl-tRNA synthetase
20	61853.ENSNLEP00000022622	0.881	methionyl-tRNA synthetase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.998	organic cyclic compound binding
GO:0004824	0.997	lysine-tRNA ligase activity
GO:0003723	0.990	RNA binding
GO:0005515	0.984	protein binding
GO:0043168	0.687	anion binding
GO:0036094	0.686	small molecule binding
GO:0097367	0.678	carbohydrate derivative binding
GO:0017076	0.667	purine nucleotide binding
GO:0032559	0.617	adenyl ribonucleotide binding
GO:0035639	0.616	purine ribonucleoside triphosphate binding
GO:0005524	0.613	ATP binding
GO:0042802	0.461	identical protein binding
GO:0016740	0.451	transferase activity
GO:0046983	0.445	protein dimerization activity
GO:0000049	0.442	tRNA binding
GO:0016779	0.437	nucleotidyltransferase activity
GO:0042803	0.395	protein homodimerization activity
GO:0070566	0.392	adenylyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0044281	0.991	small molecule metabolic process
GO:0006139	0.991	nucleobase-containing compound metabolic process
GO:0006412	0.986	translation
GO:0016070	0.976	RNA metabolic process
GO:0006418	0.970	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0032991	0.985	protein-containing complex
GO:0017101	0.970	aminoacyl-tRNA synthetase multienzyme complex
GO:0005829	0.905	cytosol
GO:0005739	0.818	mitochondrion
GO:0030054	0.788	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20792	0.997	ATP + L-lysine + tRNA(Lys) = AMP + diphosphate + L-lysyl-tRNA(Lys)
EC:6.1.1.6	0.997	lysine--tRNA ligase.
EC:2.-.-.-	0.451	Transferases.
EC:2.7.7.-	0.437	Nucleotidyltransferases.

[back to server]