StarFunc result for job id Q15047

User Input

>input (1291 residues)
MSSLPGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPT
EIIEIPDEDDDVLSIDSGDAGSRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSQMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLYVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGQLRTRP
NMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSDLESQL
AQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPAPS
ALPAPPAPPVFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRVRPMRNEQYRGKNPL
LVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFLEMFCL
DPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGKGVFIN
TGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLPTGVYE
CNKRCKCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDD
FADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGTEDPEE
SNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETTSKDSHPPDLGPPHIPVP
PSIPVGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFKTNEGGEGRAGGSRME
AEKASTSGLGIKDEGDIKQAKKEDTDDRNKMSVVTESSRNYGYNPSPVKPEGLRRPPSKT
SMHQSRRLMASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQTISSGS
EGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQF
YDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTE
LTWDYNYEVGSVEGKELLCCCGAIECRGRLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PRF4	0.407	0.416	0.000	1259	0.948	0.972	E9PRF4.pdb.gz	E9PRF4_HUMAN SET domain bifurcated histone lysine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SETDB1 PE=1 SV=1
2	AFDB:O88974	0.509	0.503	0.000	1307	0.923	0.911	O88974.pdb.gz	SETB1_MOUSE Histone-lysine N-methyltransferase SETDB1 OS=Mus musculus OX=10090 GN=Setdb1 PE=1 SV=1
3	PDB:1pegA	0.167	0.753	2.196E-9	266	0.070	0.342	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
4	AFDB:A2CG63	0.044	0.044	3.471E-5	1314	0.115	0.113	A2CG63.pdb.gz	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1
5	PDB:2ns2A	0.066	0.288	4.282E-5	201	0.029	0.189	2ns2A.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
6	AFDB:F1Q6M9	0.079	0.042	7.484E-5	2623	0.123	0.061	F1Q6M9.pdb.gz	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
7	AFDB:P32790	0.041	0.042	1.528E-4	1244	0.097	0.100	P32790.pdb.gz	SLA1_YEAST Actin cytoskeleton-regulatory complex protein SLA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLA1 PE=1 SV=1
8	AFDB:Q90WE3	0.049	0.035	2.123E-4	1905	0.117	0.079	Q90WE3.pdb.gz	TDRD6_XENLA Tudor domain-containing 6-like OS=Xenopus laevis OX=8355 GN=tdrd6 PE=1 SV=1
9	AFDB:O60336	0.052	0.047	8.844E-4	1514	0.108	0.092	O60336.pdb.gz	MABP1_HUMAN Mitogen-activated protein kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=MAPKBP1 PE=1 SV=4
10	PDB:7abi7	0.047	0.195	1.091E-3	236	0.019	0.106	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
11	PDB:5hynA	0.046	0.100	1.436E-3	581	0.015	0.034	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
12	PDB:5wg6A	0.045	0.111	1.436E-3	517	0.015	0.039	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
13	PDB:7okyZ	0.054	0.132	1.436E-3	374	0.014	0.048	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
14	AFDB:Q9I7F7	0.049	0.048	1.805E-3	1337	0.088	0.085	Q9I7F7.pdb.gz	ACKL_DROME Activated Cdc42 kinase-like OS=Drosophila melanogaster OX=7227 GN=Ack-like PE=1 SV=3
15	AFDB:Q80Z38	0.051	0.046	1.907E-3	1476	0.139	0.121	Q80Z38.pdb.gz	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
16	AFDB:B4UN32	0.042	0.044	2.248E-3	1208	0.100	0.107	B4UN32.pdb.gz	AWP3B_CANGA Adhesin AWP3b OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP3b PE=1 SV=2
17	PDB:7td5A	0.044	0.113	2.625E-3	497	0.017	0.044	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
18	PDB:6wkrC	0.045	0.096	5.661E-3	606	0.015	0.033	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
19	PDB:7td5F	0.044	0.125	7.448E-3	447	0.017	0.049	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
20	PDB:7co5H	0.044	0.132	7.868E-3	325	0.022	0.089	7co5H.pdb.gz	Molecular Basis of the Versatile Regulatory Mechanism of HtrA-Type Protease AlgW from Pseudomonas aeruginosa.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K5A7	0.0	2164	1245	0.861	0.892	A0A0G2K5A7_RAT SET domain bifurcated histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Setdb1 PE=1 SV=2
2	A0A8I6ASK2	0.0	2168	1221	0.861	0.910	A0A8I6ASK2_RAT SET domain bifurcated histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Setdb1 PE=1 SV=1
3	D4A081	0.0	2310	1322	0.917	0.896	D4A081_RAT SET domain bifurcated histone lysine methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Setdb1 PE=1 SV=2
4	E9PRF4	0.0	2535	1259	0.947	0.971	E9PRF4_HUMAN SET domain bifurcated histone lysine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=SETDB1 PE=1 SV=1
5	O88974	0.0	2353	1307	0.923	0.911	SETB1_MOUSE Histone-lysine N-methyltransferase SETDB1 OS=Mus musculus OX=10090 GN=Setdb1 PE=1 SV=1
6	Q15047	0.0	2684	1291	1.000	1.000	SETB1_HUMAN Histone-lysine N-methyltransferase SETDB1 OS=Homo sapiens OX=9606 GN=SETDB1 PE=1 SV=1
7	Q32KD2	5.88e-107	369	1262	0.197	0.201	SETB1_DROME Histone-lysine N-methyltransferase eggless OS=Drosophila melanogaster OX=7227 GN=egg PE=1 SV=1
8	A0A087WYZ9	2.70e-68	247	719	0.094	0.168	A0A087WYZ9_HUMAN Histone-lysine N-methyltransferase SETDB2 OS=Homo sapiens OX=9606 GN=SETDB2 PE=1 SV=1
9	Q96T68	2.78e-68	247	719	0.094	0.168	SETB2_HUMAN Histone-lysine N-methyltransferase SETDB2 OS=Homo sapiens OX=9606 GN=SETDB2 PE=1 SV=2
10	P34544	3.97e-47	187	1304	0.097	0.096	MET2_CAEEL Histone-lysine N-methyltransferase met-2 OS=Caenorhabditis elegans OX=6239 GN=met-2 PE=3 SV=5
11	Q06ZW3	9.47e-47	179	551	0.084	0.196	SETB2_DANRE Histone-lysine N-methyltransferase SETDB2 OS=Danio rerio OX=7955 GN=setdb2 PE=2 SV=2
12	A2ABF8	4.98e-24	112	1233	0.050	0.052	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
13	A2ABF9	5.03e-24	112	1267	0.050	0.051	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
14	A0A024RCN9	5.40e-24	112	1210	0.050	0.053	A0A024RCN9_HUMAN EHMT2 OS=Homo sapiens OX=9606 PE=4 SV=1
15	Q96KQ7	5.40e-24	112	1210	0.050	0.053	EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=3
16	Q9Z148	1.92e-23	110	1263	0.049	0.050	EHMT2_MOUSE Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus OX=10090 GN=Ehmt2 PE=1 SV=2
17	Q6MG72	2.24e-23	110	1263	0.049	0.050	Q6MG72_RAT HLA-B associated transcript 8, rat orthologue OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
18	A0A0G2JZM5	2.38e-23	110	1206	0.049	0.052	A0A0G2JZM5_RAT Euchromatic histone lysine methyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1
19	O82175	2.49e-23	109	794	0.052	0.084	SUVH5_ARATH Histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH5 OS=Arabidopsis thaliana OX=3702 GN=SUVH5 PE=1 SV=1
20	A0A0G2JTA5	2.61e-23	110	1172	0.049	0.054	A0A0G2JTA5_RAT Euchromatic histone lysine methyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Ehmt2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15057 DUF4537	33	15.9	Domain of unknown function (DUF4537)
2	PF18300 DUF5604	8.4e-38	139.5	Domain of unknown function (DUF5604)
3	PF01429 MBD	3e-09	47.8	Methyl-CpG binding domain
4	PF05033 Pre-SET	2.1e-12	59.1	Pre-SET motif
5	PF00856 SET	3.4e-42	156.2	SET domain
6	PF18358 Tudor_4	1.2e-23	93.7	Histone methyltransferase Tudor domain
7	PF18359 Tudor_5	1.8e-17	74.2	Histone methyltransferase Tudor domain 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000271640

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440440	0.999	Activating transcription factor 7-interacting protein 1
2	9606.ENSP00000362649	0.997	Histone deacetylase 1
3	9606.ENSP00000253024	0.994	Transcription intermediary factor 1-beta
4	9606.ENSP00000287820	0.993	Peroxisome proliferator-activated receptor gamma
5	9606.ENSP00000264709	0.992	DNA (cytosine-5)-methyltransferase 3A
6	9606.ENSP00000392028	0.991	Chromodomain-helicase-DNA-binding protein 7
7	9606.ENSP00000259915	0.986	POU domain, class 5, transcription factor 1
8	9606.ENSP00000476960	0.971	Histone cluster 2 H3 pseudogene 2
9	9606.ENSP00000468785	0.961	Methyl-CpG-binding domain protein 1
10	9606.ENSP00000384625	0.958	Serine/threonine-protein kinase NLK
11	9606.ENSP00000369716	0.951	Chromodomain-helicase-DNA-binding protein 3
12	9606.ENSP00000478533	0.949	Neurotrophin receptor-interacting factor homolog
13	9606.ENSP00000301280	0.937	Chromatin assembly factor 1 subunit A
14	9606.ENSP00000341280	0.936	Protein Jumonji
15	9606.ENSP00000480826	0.926	Histone cluster 1 H3 family member a
16	9606.ENSP00000209875	0.912	Chromobox protein homolog 5
17	9606.ENSP00000282032	0.901	ARL14 effector protein
18	9606.ENSP00000355778	0.893	Histone H3.3
19	9606.ENSP00000366999	0.892	Histone cluster 1 H3 family member d
20	9606.ENSP00000482271	0.892	Histone cluster 1 H3 family member e

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990841	1.000	promoter-specific chromatin binding
GO:0046974	1.000	histone H3K9 methyltransferase activity
GO:0003677	0.995	DNA binding
GO:0043565	0.508	sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.982	regulation of cellular process
GO:0009991	0.965	response to extracellular stimulus
GO:0097305	0.965	response to alcohol
GO:0045471	0.951	response to ethanol
GO:0031667	0.950	response to nutrient levels
GO:0007584	0.935	response to nutrient
GO:1902275	0.911	regulation of chromatin organization
GO:0019222	0.876	regulation of metabolic process
GO:0051252	0.865	regulation of RNA metabolic process
GO:2001141	0.861	regulation of RNA biosynthetic process
GO:0009987	0.854	cellular process
GO:0048519	0.848	negative regulation of biological process
GO:0010468	0.848	regulation of gene expression
GO:0048518	0.831	positive regulation of biological process
GO:0033273	0.812	response to vitamin
GO:0006355	0.797	regulation of DNA-templated transcription
GO:0048523	0.778	negative regulation of cellular process
GO:0048522	0.723	positive regulation of cellular process
GO:0009892	0.719	negative regulation of metabolic process
GO:0010605	0.706	negative regulation of macromolecule metabolic process
GO:0045934	0.687	negative regulation of nucleobase-containing compound metabolic process
GO:0031327	0.685	negative regulation of cellular biosynthetic process
GO:0033044	0.675	regulation of chromosome organization
GO:0010558	0.666	negative regulation of macromolecule biosynthetic process
GO:1902679	0.659	negative regulation of RNA biosynthetic process
GO:2001252	0.656	positive regulation of chromosome organization
GO:0031445	0.649	regulation of heterochromatin formation
GO:0045892	0.601	negative regulation of DNA-templated transcription
GO:0006357	0.581	regulation of transcription by RNA polymerase II
GO:0071704	0.489	organic substance metabolic process
GO:0044238	0.471	primary metabolic process
GO:0006807	0.461	nitrogen compound metabolic process
GO:0044087	0.457	regulation of cellular component biogenesis
GO:0043170	0.455	macromolecule metabolic process
GO:0044089	0.420	positive regulation of cellular component biogenesis
GO:0043412	0.410	macromolecule modification
GO:0044237	0.400	cellular metabolic process
GO:1901564	0.372	organonitrogen compound metabolic process
GO:0036211	0.361	protein modification process
GO:0009893	0.346	positive regulation of metabolic process
GO:0010604	0.338	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.857	cytoplasm
GO:0043232	0.461	intracellular non-membrane-bounded organelle
GO:0032991	0.403	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]