StarFunc result for job id Q15048

User Input

>input (493 residues)
MHTLVFLSTRQVLQCQPAACQALPLLPRELFPLLFKVAFMDKKTVVLRELVHTWPFPLLS
FQQLLQECAHCSRALLQERPSTESMQAVILGLTARLHTSEPGASTQPLCRKHALRVLDMT
GLLDDGVEQDPGTMSMWDCTAAVARTCIAQQQGGAAEPGPAPIPVEVRVDLRVNRASYAF
LREALRSSVGSPLRLCCRDLRAEDLPMRNTVALLQLLDAGCLRRVDLRFNNLGLRGLSVI
IPHVARFQHLASLRLHYVHGDSRQPSVDGEDNFRYFLAQMGRFTCLRELSMGSSLLSGRL
DQLLSTLQSPLESLELAFCALLPEDLRFLARSPHAAHLKKLDLSGNDLSGSQLAPFQGLL
QASAATLLHLELTECQLADTQLLATLPILTQCASLRYLGLYGNPLSMAGLKELLRDSVAQ
AELRTVVHPFPVDCYEGLPWPPPASVLLEASINEEKFARVEAELHQLLLASGRAHVLWTT
DIYGRLAADYFSL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15048	1.000	1.000	4.299E-92	493	1.000	1.000	Q15048.pdb.gz	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
2	AFDB:A0A024R1E6	0.583	0.568	2.057E-31	509	0.288	0.279	A0A024R1E6.pdb.gz
3	AFDB:P0DUQ2	0.551	0.567	8.845E-27	478	0.294	0.303	P0DUQ2.pdb.gz	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
4	AFDB:Q810Y8	0.615	0.630	2.436E-23	479	0.223	0.230	Q810Y8.pdb.gz	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
5	AFDB:E9Q5G7	0.548	0.545	8.413E-23	496	0.245	0.244	E9Q5G7.pdb.gz	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
6	AFDB:Q99MW3	0.507	0.539	2.251E-21	458	0.231	0.249	Q99MW3.pdb.gz	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
7	AFDB:P59047	0.468	0.222	4.522E-10	1200	0.168	0.069	P59047.pdb.gz	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2
8	AFDB:Q9R1M5	0.491	0.237	1.259E-9	1163	0.164	0.070	Q9R1M5.pdb.gz	NALP5_MOUSE NACHT, LRR and PYD domains-containing protein 5 OS=Mus musculus OX=10090 GN=Nlrp5 PE=1 SV=2
9	AFDB:Q96MN2	0.431	0.242	6.339E-9	994	0.168	0.084	Q96MN2.pdb.gz	NALP4_HUMAN NACHT, LRR and PYD domains-containing protein 4 OS=Homo sapiens OX=9606 GN=NLRP4 PE=1 SV=3
10	AFDB:Q86W24	0.394	0.215	7.863E-9	1093	0.178	0.081	Q86W24.pdb.gz	NAL14_HUMAN NACHT, LRR and PYD domains-containing protein 14 OS=Homo sapiens OX=9606 GN=NLRP14 PE=1 SV=1
11	PDB:1a4yA	0.481	0.509	1.318E-8	460	0.166	0.178	1a4yA.pdb.gz
12	PDB:4kxfP	0.422	0.260	1.036E-6	866	0.160	0.091	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
13	PDB:7pzcA	0.437	0.240	4.206E-6	1010	0.146	0.071	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
14	PDB:4i6jB	0.343	0.408	6.830E-6	394	0.112	0.140	4i6jB.pdb.gz
15	PDB:3oglB	0.353	0.316	1.051E-5	568	0.128	0.111	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
16	PDB:7pmkL	0.320	0.331	5.293E-5	475	0.112	0.116	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
17	PDB:6o60C	0.390	0.471	5.586E-5	389	0.144	0.183	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
18	PDB:3jblA	0.327	0.203	7.718E-5	909	0.118	0.064	3jblA.pdb.gz
19	PDB:1k5dC	0.457	0.627	1.066E-4	344	0.114	0.163	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
20	PDB:7sa1B	0.410	0.338	3.682E-4	624	0.138	0.109	7sa1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15048	0.0	988	493	1.000	1.000	LRC14_HUMAN Leucine-rich repeat-containing protein 14 OS=Homo sapiens OX=9606 GN=LRRC14 PE=1 SV=1
2	Q5VXH4	4.64e-49	177	476	0.292	0.303	PRAM6_HUMAN PRAME family member 6 OS=Homo sapiens OX=9606 GN=PRAMEF6 PE=1 SV=1
3	P78395	2.36e-47	173	509	0.284	0.275	PRAME_HUMAN Melanoma antigen preferentially expressed in tumors OS=Homo sapiens OX=9606 GN=PRAME PE=1 SV=1
4	P0DUQ2	7.99e-47	171	478	0.288	0.297	PRAM9_HUMAN PRAME family member 9 OS=Homo sapiens OX=9606 GN=PRAMEF9 PE=1 SV=1
5	E9Q5G7	1.06e-28	120	496	0.241	0.240	OOG1_MOUSE Oogenesin-1 OS=Mus musculus OX=10090 GN=Oog1 PE=1 SV=1
6	Q99MW3	5.99e-28	118	458	0.233	0.251	PRAL1_MOUSE Preferentially expressed antigen in melanoma-like protein 1 OS=Mus musculus OX=10090 GN=Pramel1 PE=1 SV=1
7	Q810Y8	3.68e-26	113	479	0.227	0.234	PRAL7_MOUSE Preferentially expressed antigen in melanoma-like protein 7 OS=Mus musculus OX=10090 GN=Pramel7 PE=1 SV=1
8	Q9FZ59	0.002	43.1	1088	0.089	0.040	PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana OX=3702 GN=PEPR2 PE=1 SV=1
9	Q9C000	0.009	41.2	1473	0.087	0.029	NLRP1_HUMAN NACHT, LRR and PYD domains-containing protein 1 OS=Homo sapiens OX=9606 GN=NLRP1 PE=1 SV=1
10	Q9LVM0	0.014	40.4	654	0.087	0.066	Y5830_ARATH Probable inactive receptor kinase At5g58300 OS=Arabidopsis thaliana OX=3702 GN=At5g58300 PE=1 SV=1
11	Q9LRT1	0.020	40.0	1016	0.089	0.043	Y3804_ARATH Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040 OS=Arabidopsis thaliana OX=3702 GN=At3g28040 PE=1 SV=1
12	Q9FGN6	0.026	39.7	895	0.081	0.045	Q9FGN6_ARATH Leucine-rich repeat receptor-like protein kinase OS=Arabidopsis thaliana OX=3702 GN=MOL1 PE=1 SV=1
13	Q9LJF3	0.028	39.7	1164	0.081	0.034	BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana OX=3702 GN=BRL3 PE=1 SV=1
14	Q647I9	0.054	38.9	1098	0.075	0.034	NALP5_BOVIN NACHT, LRR and PYD domains-containing protein 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=2 SV=1
15	Q8LPB4	0.082	38.1	1021	0.091	0.044	PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota OX=4039 GN=PSKR PE=1 SV=1
16	F1MT67	0.11	37.7	1098	0.075	0.034	F1MT67_BOVIN NLR family pyrin domain containing 5 OS=Bos taurus OX=9913 GN=NLRP5 PE=3 SV=3
17	Q9ZVD4	0.12	37.7	1007	0.093	0.046	Q9ZVD4_ARATH Leucine-rich repeat receptor-like protein kinase OS=Arabidopsis thaliana OX=3702 GN=LRR-RLK PE=1 SV=1
18	F4IVP3	0.13	37.4	1020	0.093	0.045	F4IVP3_ARATH Leucine-rich repeat protein kinase family protein OS=Arabidopsis thaliana OX=3702 GN=At2g27060 PE=1 SV=1
19	Q57ZL7	0.14	37.4	759	0.128	0.083	Q57ZL7_TRYB2 Ribonuclease inhibitor-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.27C5.410 PE=4 SV=1
20	P59047	0.15	37.4	1200	0.095	0.039	NALP5_HUMAN NACHT, LRR and PYD domains-containing protein 5 OS=Homo sapiens OX=9606 GN=NLRP5 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	7.2e+02	12.3	Leucine Rich Repeat
2	PF12799 LRR_4	4.6	19.1	Leucine Rich repeats (2 copies)
3	PF13516 LRR_6	0.00014	32.7	Leucine Rich repeat
4	PF20466 MmeI_TRD	5.6e+02	11.3	MmeI, target recognition domain
5	PF02197 RIIa	1.7e+02	13.3	Regulatory subunit of type II PKA R-subunit
6	PF11636 Troponin-I_N	5.4e+02	11.9	Troponin I residues 1-32

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292524

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361032	0.772	Surfeit 2
2	9606.ENSP00000386543	0.719	Prolyl endopeptidase-like
3	9606.ENSP00000383938	0.713	Cysteine rich with EGF like domains 2
4	9606.ENSP00000262306	0.673	Elongin-B
5	9606.ENSP00000434849	0.617	Leucine-rich repeat-containing protein 24
6	9606.ENSP00000376506	0.609	Programmed cell death protein 10
7	9606.ENSP00000292539	0.598	Protein phosphatase 1 regulatory subunit 16A
8	9606.ENSP00000345024	0.596	GLI family zinc finger 4
9	9606.ENSP00000436212	0.542	Zinc finger protein 707
10	9606.ENSP00000373565	0.520	Protein FAM83H
11	9606.ENSP00000421489	0.520	Tigger transposable element-derived protein 5
12	9606.ENSP00000320648	0.519	WD repeat-containing protein 97
13	9606.ENSP00000385787	0.519	Ribonucleases P/MRP protein subunit POP1
14	9606.ENSP00000445979	0.519	Zinc finger protein 623
15	9606.ENSP00000295777	0.512	Neuroserpin
16	9606.ENSP00000367755	0.501	Calmodulin-lysine N-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019900	1.000	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0023057	0.980	negative regulation of signaling
GO:0010648	0.977	negative regulation of cell communication
GO:0051252	0.968	regulation of RNA metabolic process
GO:0048585	0.935	negative regulation of response to stimulus
GO:0009966	0.905	regulation of signal transduction
GO:0032088	0.902	negative regulation of NF-kappaB transcription factor activity
GO:0080134	0.896	regulation of response to stress
GO:0031347	0.868	regulation of defense response
GO:0032101	0.858	regulation of response to external stimulus
GO:0045088	0.798	regulation of innate immune response
GO:0009987	0.749	cellular process
GO:0009968	0.606	negative regulation of signal transduction
GO:0071704	0.503	organic substance metabolic process
GO:0044238	0.485	primary metabolic process
GO:0006807	0.453	nitrogen compound metabolic process
GO:0062207	0.431	regulation of pattern recognition receptor signaling pathway
GO:0002683	0.424	negative regulation of immune system process
GO:0044237	0.416	cellular metabolic process
GO:0043170	0.329	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043231	0.953	intracellular membrane-bounded organelle
GO:0070013	0.943	intracellular organelle lumen
GO:0005634	0.810	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]