StarFunc result for job id Q15049

User Input

>input (377 residues)
MTQEPFREELAYDRMPTLERGRQDPASYAPDAKPSDLQLSKRLPPCFSHKTWVFSVLMGS
CLLVTSGFSLYLGNVFPAEMDYLRCAAGSCIPSAIVSFTVSRRNANVIPNFQILFVSTFA
VTTTCLIWFGCKLVLNPSAININFNLILLLLLELLMAATVIIAARSSEEDCKKKKGSMSD
SANILDEVPFPARVLKSYSVVEVIAGISAVLGGIIALNVDDSVSGPHLSVTFFWILVACF
PSAIASHVAAECPSKCLVEVLIAISSLTSPLLFTASGYLSFSIMRIVEMFKDYPPAIKPS
YDVLLLLLLLVLLLQAGLNTGTAIQCVRFKVSARLQGASWDTQNGPQERLAGEVARSPLK
EFDKEKAWRAVVVQMAQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R4V4	0.414	0.414	1.015E-37	377	0.973	0.973	A0A024R4V4.pdb.gz
2	AFDB:D4ABB2	0.412	0.383	1.086E-34	406	0.886	0.823	D4ABB2.pdb.gz	D4ABB2_RAT Modulator of VRAC current 1 OS=Rattus norvegicus OX=10116 GN=Mlc1 PE=1 SV=2
3	AFDB:A7MBY5	0.400	0.386	3.007E-22	391	0.538	0.519	A7MBY5.pdb.gz	A7MBY5_DANRE Membrane protein MLC1 OS=Danio rerio OX=7955 GN=si:ch211-192n14.1 PE=2 SV=1
4	AFDB:Q99788	0.200	0.204	4.498E-4	373	0.156	0.158	Q99788.pdb.gz	CML1_HUMAN Chemerin-like receptor 1 OS=Homo sapiens OX=9606 GN=CMKLR1 PE=1 SV=2
5	AFDB:Q8RXR2	0.153	0.089	7.639E-4	781	0.146	0.070	Q8RXR2.pdb.gz	CLCF_ARATH Chloride channel protein CLC-f OS=Arabidopsis thaliana OX=3702 GN=CLC-F PE=2 SV=2
6	AFDB:P25089	0.176	0.185	1.691E-3	353	0.135	0.144	P25089.pdb.gz	FPR3_HUMAN N-formyl peptide receptor 3 OS=Homo sapiens OX=9606 GN=FPR3 PE=2 SV=2
7	AFDB:O94294	0.177	0.095	1.930E-3	886	0.149	0.063	O94294.pdb.gz	SOG2_SCHPO Leucine-rich repeat-containing protein sog2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sog2 PE=1 SV=1
8	AFDB:P32300	0.171	0.173	2.303E-3	372	0.114	0.116	P32300.pdb.gz	OPRD_MOUSE Delta-type opioid receptor OS=Mus musculus OX=10090 GN=Oprd1 PE=1 SV=1
9	AFDB:Q9NXJ0	0.307	0.417	2.516E-3	267	0.077	0.109	Q9NXJ0.pdb.gz	M4A12_HUMAN Membrane-spanning 4-domains subfamily A member 12 OS=Homo sapiens OX=9606 GN=MS4A12 PE=1 SV=2
10	AFDB:O88721	0.168	0.170	3.912E-3	371	0.109	0.111	O88721.pdb.gz	V2R_MOUSE Vasopressin V2 receptor OS=Mus musculus OX=10090 GN=Avpr2 PE=1 SV=1
11	PDB:5tj5B	0.148	0.249	7.408E-2	187	0.080	0.160	5tj5B.pdb.gz
12	PDB:6s4mA	0.136	0.125	7.408E-2	426	0.111	0.099	6s4mA.pdb.gz
13	PDB:7w55R	0.186	0.223	7.742E-2	303	0.098	0.122	7w55R.pdb.gz	Structural insights into the peptide selectivity and activation of human neuromedin U receptors.
14	PDB:8dwcR	0.140	0.194	1.204E-1	250	0.111	0.168	8dwcR.pdb.gz	Ligand recognition and allosteric modulation of the human MRGPRX1 receptor.
15	PDB:7x9cR	0.151	0.166	1.315E-1	302	0.080	0.099	7x9cR.pdb.gz
16	PDB:7unmA	0.170	0.172	1.436E-1	368	0.119	0.122	7unmA.pdb.gz
17	PDB:7uw9i	0.189	0.364	1.569E-1	156	0.050	0.122	7uw9i.pdb.gz
18	PDB:5glhA	0.145	0.130	1.640E-1	452	0.114	0.095	5glhA.pdb.gz	Activation mechanism of endothelin ETB receptor by endothelin-1.
19	PDB:7vv6R	0.182	0.241	1.791E-1	271	0.130	0.181	7vv6R.pdb.gz	Structure, function and pharmacology of human itch receptor complexes.
20	PDB:5k3jA	0.205	0.139	1.956E-1	662	0.093	0.053	5k3jA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4ABB2	0.0	609	418	0.886	0.799	D4ABB2_RAT Modulator of VRAC current 1 OS=Rattus norvegicus OX=10116 GN=Mlc1 PE=1 SV=2
2	Q15049	0.0	767	377	1.000	1.000	MLC1_HUMAN Membrane protein MLC1 OS=Homo sapiens OX=9606 GN=MLC1 PE=1 SV=5
3	Q8VHK5	0.0	623	382	0.891	0.880	MLC1_MOUSE Membrane protein MLC1 OS=Mus musculus OX=10090 GN=Mlc1 PE=1 SV=1
4	A6PVC3	1.16e-156	441	223	0.592	1.000	A6PVC3_HUMAN Modulator of VRAC current 1 (Fragment) OS=Homo sapiens OX=9606 GN=MLC1 PE=1 SV=1
5	A7MBY5	5.34e-116	344	391	0.531	0.512	A7MBY5_DANRE Membrane protein MLC1 OS=Danio rerio OX=7955 GN=si:ch211-192n14.1 PE=2 SV=1
6	Q09470	0.25	35.8	495	0.109	0.083	KCNA1_HUMAN Potassium voltage-gated channel subfamily A member 1 OS=Homo sapiens OX=9606 GN=KCNA1 PE=1 SV=2
7	P10499	1.9	33.1	495	0.103	0.079	KCNA1_RAT Potassium voltage-gated channel subfamily A member 1 OS=Rattus norvegicus OX=10116 GN=Kcna1 PE=1 SV=1
8	P16388	2.1	32.7	495	0.103	0.079	KCNA1_MOUSE Potassium voltage-gated channel subfamily A member 1 OS=Mus musculus OX=10090 GN=Kcna1 PE=1 SV=1
9	A0A060KY90	2.2	32.7	630	0.050	0.030	MYC1_SOLLC Transcription factor MYC1 OS=Solanum lycopersicum OX=4081 GN=MYC1 PE=1 SV=1
10	Q9UNG2	3.1	31.6	177	0.037	0.079	TNF18_HUMAN Tumor necrosis factor ligand superfamily member 18 OS=Homo sapiens OX=9606 GN=TNFSF18 PE=1 SV=3
11	P27282	3.9	32.3	2493	0.058	0.009	POLN_EEVVT Polyprotein P1234 OS=Venezuelan equine encephalitis virus (strain Trinidad donkey) OX=11038 PE=1 SV=3
12	Q9SYI3	5.8	31.6	1230	0.074	0.023	AB5B_ARATH ABC transporter B family member 5 OS=Arabidopsis thaliana OX=3702 GN=ABCB5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382697	0.928	Rho-associated protein kinase 1
2	9606.ENSP00000353452	0.923	Myosin light chain kinase, smooth muscle
3	9606.ENSP00000379350	0.908	Integrin beta-1
4	9606.ENSP00000316029	0.904	Talin-1
5	9606.ENSP00000359719	0.904	cAMP-dependent protein kinase catalytic subunit beta
6	9606.ENSP00000385749	0.904	cAMP-dependent protein kinase type I-beta regulatory subunit
7	9606.ENSP00000341189	0.903	Focal adhesion kinase 1
8	9606.ENSP00000265717	0.902	cAMP-dependent protein kinase type II-beta regulatory subunit
9	9606.ENSP00000295006	0.902	Calpain-2 catalytic subunit
10	9606.ENSP00000282588	0.901	Integrin alpha-1
11	9606.ENSP00000246533	0.900	Calpain small subunit 1
12	9606.ENSP00000265563	0.900	cAMP-dependent protein kinase type II-alpha regulatory subunit
13	9606.ENSP00000267257	0.900	Paxillin
14	9606.ENSP00000366488	0.900	cAMP-dependent protein kinase catalytic subunit gamma
15	9606.ENSP00000376475	0.900	cAMP-dependent protein kinase type I-alpha regulatory subunit
16	9606.ENSP00000379157	0.900	Calpastatin
17	9606.ENSP00000476755	0.900	Protein phosphatase 1 regulatory subunit 12B
18	9606.ENSP00000450385	0.769	Myosin light chain 6B
19	9606.ENSP00000307280	0.764	Myosin light chain 1/3, skeletal muscle isoform
20	9606.ENSP00000446955	0.764	Myosin light polypeptide 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.999	protein-containing complex binding
GO:0042802	0.799	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.958	regulation of cellular process
GO:0009987	0.938	cellular process
GO:0048518	0.837	positive regulation of biological process
GO:0048583	0.799	regulation of response to stimulus
GO:0080134	0.758	regulation of response to stress
GO:0047484	0.743	regulation of response to osmotic stress
GO:0032879	0.737	regulation of localization
GO:0060341	0.700	regulation of cellular localization
GO:0032386	0.632	regulation of intracellular transport
GO:0048522	0.576	positive regulation of cellular process
GO:0051050	0.532	positive regulation of transport
GO:0050896	0.438	response to stimulus
GO:0032388	0.404	positive regulation of intracellular transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005886	0.965	plasma membrane
GO:0043229	0.958	intracellular organelle
GO:0043227	0.956	membrane-bounded organelle
GO:0012505	0.909	endomembrane system
GO:0043231	0.760	intracellular membrane-bounded organelle
GO:0005783	0.510	endoplasmic reticulum
GO:0098590	0.473	plasma membrane region
GO:0031982	0.434	vesicle
GO:0070161	0.394	anchoring junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]