StarFunc result for job id Q15056

User Input

>input (248 residues)
MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDA
IFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRK
QDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPM
GSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPRE
EVVQKEQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15056	1.000	1.000	1.132E-43	248	1.000	1.000	Q15056.pdb.gz	IF4H_HUMAN Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5
2	AFDB:F8VX11	0.340	0.242	2.288E-13	360	0.355	0.244	F8VX11.pdb.gz	F8VX11_HUMAN Eukaryotic translation initiation factor 4B (Fragment) OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=1
3	AFDB:O14369	0.351	0.233	2.443E-13	388	0.290	0.186	O14369.pdb.gz	SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sce3 PE=1 SV=1
4	AFDB:J9VI89	0.383	0.196	4.121E-12	511	0.315	0.153	J9VI89.pdb.gz	TIF3_CRYNH Probable eukaryotic translation initiation factor 4H OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=TIF3 PE=1 SV=2
5	AFDB:E7EX17	0.336	0.144	1.259E-11	616	0.371	0.149	E7EX17.pdb.gz	E7EX17_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=1
6	AFDB:F8VP89	0.317	0.288	3.848E-11	275	0.278	0.251	F8VP89.pdb.gz	F8VP89_HUMAN Eukaryotic translation initiation factor 4B (Fragment) OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=1
7	AFDB:Q7PLL3	0.302	0.166	2.423E-10	459	0.226	0.122	Q7PLL3.pdb.gz	Q7PLL3_DROME Eukaryotic initiation factor 4B OS=Drosophila melanogaster OX=7227 GN=eIF4B PE=1 SV=1
8	AFDB:D6W5Y5	0.325	0.275	3.837E-10	297	0.238	0.199	D6W5Y5.pdb.gz	D6W5Y5_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1
9	AFDB:O45781	0.310	0.364	5.692E-10	207	0.250	0.300	O45781.pdb.gz	O45781_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=drr-2 PE=1 SV=1
10	AFDB:Q84TH4	0.305	0.202	7.906E-10	382	0.226	0.147	Q84TH4.pdb.gz	SR45A_ARATH Serine/arginine-rich splicing factor SR45a OS=Arabidopsis thaliana OX=3702 GN=SR45A PE=1 SV=1
11	PDB:6g90B	0.302	0.383	6.892E-8	193	0.121	0.155	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
12	PDB:7dvqY	0.290	0.503	1.847E-7	140	0.105	0.186	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:6qx91K	0.310	0.379	2.565E-7	201	0.089	0.109	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	PDB:5gm6V	0.307	0.577	3.336E-7	128	0.097	0.188	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:6n7pA	0.294	0.386	6.435E-7	186	0.113	0.151	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
16	PDB:5oobB	0.302	0.480	1.326E-6	152	0.117	0.191	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
17	PDB:6gd1A	0.299	0.385	1.615E-6	190	0.077	0.100	6gd1A.pdb.gz
18	PDB:5yzg1	0.297	0.303	2.100E-6	243	0.085	0.086	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:5xjcw	0.300	0.772	4.326E-6	91	0.069	0.187	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
20	PDB:6qw6R	0.297	0.640	6.009E-6	106	0.073	0.170	6qw6R.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15056	1.00e-178	492	248	1.000	1.000	IF4H_HUMAN Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H PE=1 SV=5
2	Q9WUK2	9.13e-177	487	248	0.988	0.988	IF4H_MOUSE Eukaryotic translation initiation factor 4H OS=Mus musculus OX=10090 GN=Eif4h PE=1 SV=3
3	O14369	1.09e-16	80.5	388	0.315	0.201	SCE3_SCHPO Probable RNA-binding protein sce3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sce3 PE=1 SV=1
4	F8VX11	1.51e-15	77.0	360	0.355	0.244	F8VX11_HUMAN Eukaryotic translation initiation factor 4B (Fragment) OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=1
5	J9VI89	2.69e-15	77.0	511	0.185	0.090	TIF3_CRYNH Probable eukaryotic translation initiation factor 4H OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=TIF3 PE=1 SV=2
6	Q5RKG9	2.59e-13	71.2	611	0.165	0.067	Q5RKG9_RAT Eukaryotic translation initiation factor 4B OS=Rattus norvegicus OX=10116 GN=Eif4b PE=1 SV=1
7	F8W0K0	2.88e-13	67.8	169	0.190	0.278	F8W0K0_HUMAN Eukaryotic translation initiation factor 4B (Fragment) OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=8
8	P23588	5.18e-13	70.5	611	0.161	0.065	IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2
9	E7EX17	5.50e-13	70.1	616	0.161	0.065	E7EX17_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=1
10	F8VP89	2.13e-12	67.4	275	0.161	0.145	F8VP89_HUMAN Eukaryotic translation initiation factor 4B (Fragment) OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=1
11	Q7PLL1	6.70e-11	63.5	389	0.234	0.149	Q7PLL1_DROME Eukaryotic translation initiation factor 4B, isoform E OS=Drosophila melanogaster OX=7227 GN=eIF4B PE=1 SV=2
12	Q7PLL3	6.78e-11	63.9	459	0.234	0.126	Q7PLL3_DROME Eukaryotic initiation factor 4B OS=Drosophila melanogaster OX=7227 GN=eIF4B PE=1 SV=1
13	L7EEF1	7.13e-11	63.5	392	0.234	0.148	L7EEF1_DROME Eukaryotic translation initiation factor 4B, isoform F OS=Drosophila melanogaster OX=7227 GN=eIF4B PE=1 SV=1
14	Q8SYL3	7.58e-11	63.5	390	0.234	0.149	Q8SYL3_DROME Eukaryotic initiation factor 4B OS=Drosophila melanogaster OX=7227 GN=eIF4B PE=1 SV=1
15	Q04836	1.49e-09	59.7	329	0.125	0.094	CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31A PE=1 SV=1
16	P41891	2.01e-09	59.7	500	0.121	0.060	GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gar2 PE=1 SV=2
17	Q9M3B8	2.48e-09	59.3	597	0.109	0.045	PHIP1_ARATH Phragmoplastin interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=PHIP1 PE=1 SV=1
18	O45713	3.46e-09	54.7	85	0.113	0.329	O45713_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rbm-3.2 PE=1 SV=1
19	A2A2V2	7.26e-09	57.8	408	0.129	0.078	A2A2V2_HUMAN RNA binding motif protein 34 (Fragment) OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=1
20	P42696	8.30e-09	57.8	430	0.129	0.074	RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06273 eIF-4B	3.1	18.4	Plant specific eukaryotic initiation factor 4B
2	PF00076 RRM_1	2.4e-09	48.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000265753

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000293831	0.995	Eukaryotic initiation factor 4A-I
2	9606.ENSP00000326381	0.979	Eukaryotic initiation factor 4A-II
3	9606.ENSP00000416255	0.938	Eukaryotic translation initiation factor 4 gamma 1
4	9606.ENSP00000425561	0.933	Eukaryotic translation initiation factor 4E
5	9606.ENSP00000433664	0.904	Eukaryotic translation initiation factor 4 gamma 2
6	9606.ENSP00000388806	0.857	Eukaryotic translation initiation factor 4B
7	9606.ENSP00000383274	0.842	Eukaryotic translation initiation factor 4 gamma 3
8	9606.ENSP00000398350	0.840	UPF0696 protein C11orf68
9	9606.ENSP00000362820	0.815	Serine/arginine-rich splicing factor 3
10	9606.ENSP00000308472	0.804	Eukaryotic translation initiation factor 4E-binding protein 3
11	9606.ENSP00000272348	0.799	Small nuclear ribonucleoprotein G
12	9606.ENSP00000307940	0.764	Elongation factor 2
13	9606.ENSP00000431800	0.764	Eukaryotic translation initiation factor 3 subunit F
14	9606.ENSP00000316042	0.761	Heterogeneous nuclear ribonucleoprotein A0
15	9606.ENSP00000216554	0.759	Eukaryotic translation initiation factor 5
16	9606.ENSP00000223398	0.748	CAP-Gly domain-containing linker protein 2
17	9606.ENSP00000293677	0.747	Ribonucleoprotein PTB-binding 1
18	9606.ENSP00000269349	0.745	Eukaryotic initiation factor 4A-III
19	9606.ENSP00000258416	0.738	Eukaryotic translation initiation factor 4E type 2
20	9606.ENSP00000336740	0.730	LIM domain kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0003743	1.000	translation initiation factor activity
GO:0045296	0.999	cadherin binding
GO:0003729	0.446	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.978	regulation of biological process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0050794	0.968	regulation of cellular process
GO:0010468	0.924	regulation of gene expression
GO:0080090	0.866	regulation of primary metabolic process
GO:0051171	0.866	regulation of nitrogen compound metabolic process
GO:2000112	0.851	regulation of cellular macromolecule biosynthetic process
GO:0034248	0.849	regulation of amide metabolic process
GO:0006417	0.836	regulation of translation
GO:0009987	0.816	cellular process
GO:0071704	0.789	organic substance metabolic process
GO:0044237	0.712	cellular metabolic process
GO:0006807	0.711	nitrogen compound metabolic process
GO:0044238	0.709	primary metabolic process
GO:0043170	0.701	macromolecule metabolic process
GO:0034641	0.653	cellular nitrogen compound metabolic process
GO:0032502	0.641	developmental process
GO:0006446	0.621	regulation of translational initiation
GO:0040007	0.616	growth
GO:0010467	0.519	gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005829	0.998	cytosol
GO:0016020	0.978	membrane
GO:0043229	0.850	intracellular organelle
GO:0016281	0.777	eukaryotic translation initiation factor 4F complex
GO:0043231	0.685	intracellular membrane-bounded organelle
GO:0005634	0.457	nucleus
GO:0070013	0.388	intracellular organelle lumen
GO:0031981	0.382	nuclear lumen
GO:0005654	0.337	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]