StarFunc result for job id Q15057

User Input

>input (778 residues)
MKMTVDFEECLKDSPRFRAALEEVEGDVAELELKLDKLVKLCIAMIDTGKAFCVANKQFM
NGIRDLAQYSSNDAVVETSLTKFSDSLQEMINFHTILFDQTQRSIKAQLQNFVKEDLRKF
KDAKKQFEKVSEEKENALVKNAQVQRNKQHEVEEATNILTATRKCFRHIALDYVLQINVL
QSKRRSEILKSMLSFMYAHLAFFHQGYDLFSELGPYMKDLGAQLDRLVVDAAKEKREMEQ
KHSTIQQKDFSSDDSKLEYNVDAANGIVMEGYLFKRASNAFKTWNRRWFSIQNNQLVYQK
KFKDNPTVVVEDLRLCTVKHCEDIERRFCFEVVSPTKSCMLQADSEKLRQAWIKAVQTSI
ATAYREKGDESEKLDKKSSPSTGSLDSGNESKEKLLKGESALQRVQCIPGNASCCDCGLA
DPRWASINLGITLCIECSGIHRSLGVHFSKVRSLTLDTWEPELLKLMCELGNDVINRVYE
ANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRLS
ISKFGPGDQVRASAQSSVRSNDSGIQQSSDDGRESLPSTVSANSLYEPEGERQDSSMFLD
SKHLNPGLQLYRASYEKNLPKMAEALAHGADVNWANSEENKATPLIQAVLGGSLVTCEFL
LQNGANVNQRDVQGRGPLHHATVLGHTGQVCLFLKRGANQHATDEEGKDPLSIAVEAANA
DIVTLLRLARMNEEMRESEGLYGQPGDETYQDIFRDFSQMASNNPEKLNRFQQDSQKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15057	1.000	1.000	0.000	778	1.000	1.000	Q15057.pdb.gz	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
2	AFDB:Q3UH98	0.657	0.621	7.415E-75	833	0.621	0.580	Q3UH98.pdb.gz	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
3	AFDB:Q15027	0.637	0.663	3.069E-67	740	0.513	0.539	Q15027.pdb.gz	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
4	AFDB:Q9VCQ6	0.723	0.684	8.539E-57	828	0.411	0.386	Q9VCQ6.pdb.gz	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
5	AFDB:Q9XXH8	0.426	0.402	2.484E-46	826	0.324	0.305	Q9XXH8.pdb.gz	CNT1_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 OS=Caenorhabditis elegans OX=6239 GN=cnt-1 PE=1 SV=2
6	AFDB:Q551Q8	0.406	0.377	3.709E-41	843	0.280	0.259	Q551Q8.pdb.gz	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
7	AFDB:Q5W7F2	0.405	0.384	1.914E-35	827	0.269	0.253	Q5W7F2.pdb.gz	AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana OX=3702 GN=AGD3 PE=1 SV=1
8	AFDB:Q9FIT8	0.391	0.369	1.030E-34	828	0.261	0.245	Q9FIT8.pdb.gz	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
9	AFDB:Q54WI0	0.300	0.186	1.031E-31	1333	0.217	0.127	Q54WI0.pdb.gz	Q54WI0_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279649 PE=4 SV=1
10	AFDB:Q9QWY8	0.404	0.286	5.807E-29	1147	0.203	0.138	Q9QWY8.pdb.gz	ASAP1_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Asap1 PE=1 SV=2
11	PDB:3lvqE	0.291	0.528	1.993E-12	420	0.108	0.200	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism
12	PDB:3ljuX	0.143	0.292	7.218E-7	373	0.059	0.123	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
13	PDB:6jd6B	0.146	0.558	2.090E-5	192	0.042	0.172	6jd6B.pdb.gz
14	PDB:3o47A	0.113	0.264	3.886E-5	289	0.055	0.149	3o47A.pdb.gz	Crystal structure of ARFGAP1-ARF1 fusion protein
15	PDB:1bd8A	0.142	0.650	4.062E-5	156	0.046	0.231	1bd8A.pdb.gz
16	PDB:3ehqA	0.142	0.588	4.849E-5	182	0.044	0.187	3ehqA.pdb.gz
17	PDB:4mt6A	0.121	0.232	5.299E-5	389	0.055	0.111	4mt6A.pdb.gz
18	PDB:8cs9A	0.150	0.146	5.789E-5	796	0.049	0.048	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
19	PDB:7df7B	0.140	0.872	9.015E-5	119	0.042	0.277	7df7B.pdb.gz
20	PDB:4mk0A	0.129	0.158	1.467E-4	631	0.046	0.057	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2ADA6	0.0	763	829	0.459	0.431	A2ADA6_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
2	Q15027	0.0	749	740	0.515	0.542	ACAP1_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1
3	Q15057	0.0	1621	778	1.000	1.000	ACAP2_HUMAN Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3
4	Q3UH98	0.0	756	833	0.458	0.427	Q3UH98_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
5	Q4QQN0	0.0	756	626	0.459	0.570	Q4QQN0_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
6	Q5FVC7	0.0	1539	770	0.950	0.960	ACAP2_RAT Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Acap2 PE=1 SV=1
7	Q6NXL5	0.0	757	833	0.459	0.429	Q6NXL5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein OS=Mus musculus OX=10090 GN=Acap3 PE=1 SV=1
8	Q6ZQK5	0.0	1542	770	0.952	0.962	ACAP2_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Mus musculus OX=10090 GN=Acap2 PE=1 SV=2
9	Q9VCQ6	3.31e-154	472	828	0.393	0.370	Q9VCQ6_DROME Centaurin beta 1A OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
10	Q8T0R1	2.53e-147	452	767	0.306	0.310	Q8T0R1_DROME GH12888p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
11	Q9XXH8	2.70e-122	388	826	0.350	0.329	CNT1_CAEEL Arf-GAP with ANK repeat and PH domain-containing protein cnt-1 OS=Caenorhabditis elegans OX=6239 GN=cnt-1 PE=1 SV=2
12	Q7KS50	7.03e-76	259	598	0.176	0.229	Q7KS50_DROME Centaurin beta 1A, isoform B OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=1 SV=1
13	Q8MSZ5	1.42e-62	211	235	0.148	0.489	Q8MSZ5_DROME GM06875p OS=Drosophila melanogaster OX=7227 GN=CenB1A PE=2 SV=1
14	Q8C8T5	8.75e-59	201	215	0.130	0.470	Q8C8T5_MOUSE Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Acap3 PE=2 SV=1
15	Q9FIT8	2.77e-57	212	828	0.276	0.260	AGD1_ARATH ADP-ribosylation factor GTPase-activating protein AGD1 OS=Arabidopsis thaliana OX=3702 GN=AGD1 PE=2 SV=2
16	Q5W7F2	5.41e-52	196	827	0.265	0.249	AGD3_ARATH ADP-ribosylation factor GTPase-activating protein AGD3 OS=Arabidopsis thaliana OX=3702 GN=AGD3 PE=1 SV=1
17	Q8TDY4	5.67e-48	185	903	0.190	0.164	ASAP3_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ASAP3 PE=1 SV=1
18	Q551Q8	1.18e-46	181	843	0.147	0.135	Q551Q8_DICDI Ankyrin repeat-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0276395 PE=4 SV=1
19	O43150	1.66e-43	172	1006	0.189	0.146	ASAP2_HUMAN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3
20	O97902	3.42e-43	171	1129	0.168	0.116	ASAP1_BOVIN Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Bos taurus OX=9913 GN=ASAP1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	0.0026	29.3	Ankyrin repeat
2	PF12796 Ank_2	8.2e-11	53.7	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	0.29	22.7	Ankyrin repeat
4	PF13637 Ank_4	0.033	26.0	Ankyrin repeats (many copies)
5	PF13857 Ank_5	4.1e-07	41.4	Ankyrin repeats (many copies)
6	PF01412 ArfGap	2.9e-36	135.5	Putative GTPase activating protein for Arf
7	PF16746 BAR_3	1.7e-84	294.7	BAR domain of APPL family
8	PF00169 PH	4.9e-11	54.4	PH domain
9	PF15409 PH_8	2.4e+02	13.4	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000010182

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000000319	0.882	RAB35, member RAS oncogene family
2	61853.ENSNLEP00000014687	0.815	ADP-ribosylation factor 6
3	61853.ENSNLEP00000007932	0.710	GULP, engulfment adaptor PTB domain containing 1
4	61853.ENSNLEP00000014863	0.690	Uncharacterized protein
5	61853.ENSNLEP00000003518	0.661	Cordon-bleu WH2 repeat protein-like 1
6	61853.ENSNLEP00000005714	0.650	Ubiquitin protein ligase E3 component n-recognin 1
7	61853.ENSNLEP00000014698	0.637	Multiple inositol-polyphosphate phosphatase 1
8	61853.ENSNLEP00000020934	0.637	Transmembrane protein 33
9	61853.ENSNLEP00000005449	0.630	RUN and SH3 domain containing 2
10	61853.ENSNLEP00000017256	0.616	ADP-ribosylation factor 1
11	61853.ENSNLEP00000015353	0.605	Microtubule associated monooxygenase, calponin and LIM domain containing 1
12	61853.ENSNLEP00000018206	0.605	MICAL-like 1
13	61853.ENSNLEP00000009832	0.602	Solute carrier family 2 (facilitated glucose transporter), member 4
14	61853.ENSNLEP00000023782	0.591	High mobility group 20A
15	61853.ENSNLEP00000018473	0.549	OCRL, inositol polyphosphate-5-phosphatase
16	61853.ENSNLEP00000008864	0.548	ADP-ribosylation factor 4
17	61853.ENSNLEP00000015230	0.543	Uncharacterized protein
18	61853.ENSNLEP00000006697	0.537	Cancer susceptibility candidate 4
19	61853.ENSNLEP00000020957	0.531	DENN/MADD domain containing 1A
20	61853.ENSNLEP00000009865	0.517	RAB11 family interacting protein 3 (class II)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005096	1.000	GTPase activator activity
GO:0005515	0.997	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.969	localization
GO:0051234	0.946	establishment of localization
GO:0006810	0.944	transport
GO:0016192	0.917	vesicle-mediated transport
GO:0051641	0.855	cellular localization
GO:0050896	0.838	response to stimulus
GO:0030029	0.785	actin filament-based process
GO:0051668	0.730	localization within membrane
GO:0065007	0.712	biological regulation
GO:0051649	0.645	establishment of localization in cell
GO:0009719	0.601	response to endogenous stimulus
GO:0070848	0.586	response to growth factor
GO:0050789	0.495	regulation of biological process
GO:0046907	0.481	intracellular transport
GO:0016197	0.451	endosomal transport
GO:0050794	0.427	regulation of cellular process
GO:0071840	0.426	cellular component organization or biogenesis
GO:1990089	0.408	response to nerve growth factor
GO:0016043	0.394	cellular component organization
GO:0098876	0.327	vesicle-mediated transport to the plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.998	endomembrane system
GO:0031982	0.997	vesicle
GO:0097708	0.979	intracellular vesicle
GO:0120025	0.966	plasma membrane bounded cell projection
GO:0071944	0.951	cell periphery
GO:0031410	0.945	cytoplasmic vesicle
GO:0031090	0.934	organelle membrane
GO:0005886	0.932	plasma membrane
GO:0005829	0.931	cytosol
GO:0098588	0.895	bounding membrane of organelle
GO:0005768	0.850	endosome
GO:0030659	0.742	cytoplasmic vesicle membrane
GO:0031252	0.573	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]