StarFunc result for job id Q15058

User Input

>input (1648 residues)
MSLHSTHNRNNSGDILDIPSSQNSSSLNALTHSSRLKLHLKSDMSECENDDPLLRSAGKV
RDINRTYVISASRKTADMPLTPNPVGRLALQRRTTRNKESSLLVSELEDTTEKTAETRLT
LQRRAKTDSAEKWKTAEIDSVKMTLNVGGETENNGVSKESRTNVRIVNNAKNSFVASSVP
LDEDPQVIEMMADKKYKETFSAPSRANENVALKYSSNRPPIASLSQTEVVRSGHLTTKPT
QSKLDIKVLGTGNLYHRSIGKEIAKTSNKFGSLEKRTPTKCTTEHKLTTKCSLPQLKSPA
PSILKNRMSNLQVKQRPKSSFLANKQERSAENTILPEEETVVQNTSAGKDPLKVENSQVT
VAVRVRPFTKREKIEKASQVVFMSGKEITVEHPDTKQVYNFIYDVSFWSFDECHPHYASQ
TTVYEKLAAPLLERAFEGFNTCLFAYGQTGSGKSYTMMGFSEEPGIIPRFCEDLFSQVAR
KQTQEVSYHIEMSFFEVYNEKIHDLLVCKDENGQRKQPLRVREHPVYGPYVEALSMNIVS
SYADIQSWLELGNKQRATAATGMNDKSSRSHSVFTLVMTQTKTEFVEGEEHDHRITSRIN
LIDLAGSERCSTAHTNGDRLKEGVSINKSLLTLGKVISALSEQANQRSVFIPYRESVLTW
LLKESLGGNSKTAMIATISPAASNIEETLSTLRYANQARLIVNIAKVNEDMNAKLIRELK
AEIAKLKAAQRNSRNIDPERYRLCRQEITSLRMKLHQQERDMAEMQRVWKEKFEQAEKRK
LQETKELQKAGIMFQMDNHLPNLVNLNEDPQLSEMLLYMIKEGTTTVGKYKPNSSHDIQL
SGVLIADDHCTIKNFGGTVSIIPVGEAKTYVNGKHILEITVLRHGDRVILGGDHYFRFNH
PVEVQKGKRPSGRDTPISEGPKDFEFAKNELLMAQRSQLEAEIKEAQLKAKEEMMQGIQI
AKEMAQQELSSQKAAYESKIKALEAELREESQRKKMQEINNQKANHKIEELEKAKQHLEQ
EIYVNKKRLEMETLATKQALEDHSIRHARILEALETEKQKIAKEVQILQQNRNNRDKTFT
VQTTWSSMKLSMMIQEANAISSKLKTYYVFGRHDISDKSSSDTSIRVRNLKLGISTFWSL
EKFESKLAAMKELYESNGSNRGEDAFCDPEDEWEPDITDAPVSSLSRRRSRSLMKNRRIS
GCLHDIQVHPIKNLHSSHSSGLMDKSSTIYSNSAESFLPGICKELIGSSLDFFGQSYDEE
RTIADSLINSFLKIYNGLFAISKAHEEQDEESQDNLFSSDRAIQSLTIQTACAFEQLVVL
MKHWLSDLLPCTNIARLEDELRQEVKKLGGYLQLFLQGCCLDISSMIKEAQKNAIQIVQQ
AVKYVGQLAVLKGSKLHFLENGNNKAASVQEEFMDAVCDGVGLGMKILLDSGLEKAKELQ
HELFRQCTKNEVTKEMKTNAMGLIRSLENIFAESKIKSFRRQVQEENFEYQDFKRMVNRA
PEFLKLKHCLEKAIEIIISALKGCHSDINLLQTCVESIRNLASDFYSDFSVPSTSVGSYE
SRVTHIVHQELESLAKSLLFCFESEESPDLLKPWETYNQNTKEEHQQSKSSGIDGSKNKG
VPKRVYELHGSSPAVSSEECTPSRIQWV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:L0N7N1	0.377	0.371	0.000	1674	0.719	0.708	L0N7N1.pdb.gz	KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus OX=10090 GN=Kif14 PE=1 SV=1
2	AFDB:Q15058	1.000	1.000	0.000	1648	1.000	1.000	Q15058.pdb.gz	KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens OX=9606 GN=KIF14 PE=1 SV=1
3	AFDB:Q9H1H9	0.281	0.258	2.399E-52	1805	0.180	0.165	Q9H1H9.pdb.gz	KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2
4	AFDB:Q9EQW7	0.289	0.273	2.629E-52	1749	0.175	0.165	Q9EQW7.pdb.gz	KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus OX=10090 GN=Kif13a PE=1 SV=1
5	PDB:7wrgA	0.281	0.546	4.018E-47	812	0.150	0.305	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
6	PDB:7wrgB	0.272	0.548	2.471E-44	783	0.149	0.313	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
7	PDB:4h1gA	0.168	0.401	1.145E-20	670	0.066	0.163	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
8	AFDB:Q586D8	0.159	0.171	1.133E-15	1522	0.065	0.070	Q586D8.pdb.gz	Q586D8_TRYB2 Present in the outer mitochondrial membrane proteome 22 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=1F7.135 PE=4 SV=1
9	AFDB:Q57UP1	0.176	0.314	3.633E-12	894	0.079	0.147	Q57UP1.pdb.gz	Q57UP1_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.480 PE=3 SV=1
10	PDB:2kb3A	0.054	0.547	5.707E-5	143	0.013	0.154	2kb3A.pdb.gz
11	PDB:2ff4A	0.056	0.236	7.447E-4	379	0.030	0.132	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
12	PDB:3ay5A	0.104	0.399	6.733E-3	298	0.022	0.124	3ay5A.pdb.gz
13	AFDB:Q13009	0.046	0.047	1.209E-2	1591	0.110	0.114	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
14	AFDB:Q9UPV0	0.060	0.066	1.387E-2	1460	0.121	0.136	Q9UPV0.pdb.gz	CE164_HUMAN Centrosomal protein of 164 kDa OS=Homo sapiens OX=9606 GN=CEP164 PE=1 SV=3
15	AFDB:Q8IUG5	0.076	0.054	2.890E-2	2567	0.163	0.104	Q8IUG5.pdb.gz	MY18B_HUMAN Unconventional myosin-XVIIIb OS=Homo sapiens OX=9606 GN=MYO18B PE=1 SV=2
16	AFDB:E9PV66	0.076	0.056	3.168E-2	2605	0.167	0.106	E9PV66.pdb.gz	E9PV66_MOUSE Myosin XVIIIb OS=Mus musculus OX=10090 GN=Myo18b PE=1 SV=1
17	PDB:7b93L	0.062	0.110	8.786E-2	607	0.028	0.076	7b93L.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
18	PDB:7unmA	0.063	0.185	1.455E-1	368	0.021	0.095	7unmA.pdb.gz
19	PDB:4k1nA	0.048	0.128	1.916E-1	520	0.030	0.096	4k1nA.pdb.gz
20	PDB:7ehlA	0.050	0.110	2.100E-1	563	0.032	0.092	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	L0N7N1	0.0	2323	1674	0.722	0.711	KIF14_MOUSE Kinesin-like protein KIF14 OS=Mus musculus OX=10090 GN=Kif14 PE=1 SV=1
2	Q15058	0.0	3427	1648	1.000	1.000	KIF14_HUMAN Kinesin-like protein KIF14 OS=Homo sapiens OX=9606 GN=KIF14 PE=1 SV=1
3	R4JU55	0.0	939	1540	0.313	0.335	R4JU55_XENLA Nuclear and meiotic actin-bundling kinesin OS=Xenopus laevis OX=8355 GN=NabKin PE=2 SV=1
4	P23678	2.93e-152	509	1584	0.198	0.206	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
5	A1ZAJ2	6.32e-152	509	1670	0.192	0.190	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
6	O18390	1.54e-148	488	1121	0.175	0.257	O18390_DROME Kinesin-like protein unc-104 (Fragment) OS=Drosophila melanogaster OX=7227 GN=neb PE=2 SV=1
7	Q960F4	1.99e-148	484	1013	0.174	0.283	Q960F4_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=neb PE=2 SV=1
8	Q7JMZ1	4.47e-148	486	1121	0.174	0.256	Q7JMZ1_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=neb PE=2 SV=1
9	Q7KQ58	5.00e-148	486	1121	0.175	0.257	Q7KQ58_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=neb PE=3 SV=1
10	O16866	5.82e-148	486	1121	0.174	0.256	O16866_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=neb PE=2 SV=2
11	Q9VIP4	6.84e-148	486	1121	0.174	0.256	Q9VIP4_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=neb PE=1 SV=1
12	E9QDE5	1.62e-147	499	1763	0.178	0.166	E9QDE5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
13	F1QJ64	1.86e-147	486	1161	0.173	0.245	F1QJ64_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
14	F1QBV5	2.15e-147	499	1770	0.177	0.165	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
15	Q96L93	2.39e-144	481	1317	0.182	0.228	KI16B_HUMAN Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B PE=1 SV=2
16	B1AVY7	1.07e-143	479	1312	0.159	0.200	KI16B_MOUSE Kinesin-like protein KIF16B OS=Mus musculus OX=10090 GN=Kif16b PE=1 SV=1
17	A4UZI0	5.44e-141	482	1899	0.186	0.162	A4UZI0_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
18	A0A0B4LGK5	7.11e-141	482	1913	0.186	0.160	A0A0B4LGK5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
19	A1ZA18	7.81e-141	482	1921	0.186	0.160	A1ZA18_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
20	A0A0B4KFR5	8.17e-141	482	1957	0.186	0.157	A0A0B4KFR5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00498 FHA	0.0028	29.3	FHA domain
2	PF00225 Kinesin	1.3e-107	371.3	Kinesin motor domain
3	PF16183 Kinesin_assoc	1.5e-08	46.6	Kinesin-associated
4	PF16796 Microtub_bd	2e-20	84.7	Microtubule binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356319

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377793	0.989	Protein regulator of cytokinesis 1
2	9606.ENSP00000376306	0.985	Citron Rho-interacting kinase
3	9606.ENSP00000356379	0.978	Abnormal spindle-like microcephaly-associated protein
4	9606.ENSP00000360540	0.935	Centrosomal protein of 55 kDa
5	9606.ENSP00000358813	0.933	Dual specificity protein kinase TTK
6	9606.ENSP00000355922	0.926	Centromere protein F
7	9606.ENSP00000265748	0.922	Anillin
8	9606.ENSP00000378356	0.922	Kinesin-like protein KIF20A
9	9606.ENSP00000313950	0.911	Aurora kinase B
10	9606.ENSP00000247191	0.909	Disks large-associated protein 5
11	9606.ENSP00000357643	0.907	Proliferation marker protein Ki-67
12	9606.ENSP00000378699	0.906	Cyclin-dependent kinase 1
13	9606.ENSP00000302530	0.902	Mitotic checkpoint serine/threonine-protein kinase BUB1
14	9606.ENSP00000453403	0.901	Nucleolar and spindle-associated protein 1
15	9606.ENSP00000251496	0.896	Condensin complex subunit 3
16	9606.ENSP00000300403	0.892	Targeting protein for Xklp2
17	9606.ENSP00000363524	0.891	Chromosome-associated kinesin KIF4A
18	9606.ENSP00000411532	0.890	DNA topoisomerase 2-alpha
19	9606.ENSP00000260363	0.885	Kinesin-like protein KIF23
20	9606.ENSP00000260731	0.879	Kinesin-like protein KIF11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140657	0.999	ATP-dependent activity
GO:0030165	0.999	PDZ domain binding
GO:0019900	0.996	kinase binding
GO:0019901	0.991	protein kinase binding
GO:0003774	0.955	cytoskeletal motor activity
GO:0003777	0.855	microtubule motor activity
GO:0008574	0.641	plus-end-directed microtubule motor activity
GO:0003824	0.389	catalytic activity
GO:0097159	0.362	organic cyclic compound binding
GO:1901363	0.354	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.996	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0071840	0.957	cellular component organization or biogenesis
GO:0016043	0.950	cellular component organization
GO:0007059	0.918	chromosome segregation
GO:1903047	0.904	mitotic cell cycle process
GO:0051276	0.900	chromosome organization
GO:0051641	0.895	cellular localization
GO:0000819	0.836	sister chromatid segregation
GO:0048285	0.826	organelle fission
GO:0051726	0.811	regulation of cell cycle
GO:0048519	0.803	negative regulation of biological process
GO:0010564	0.801	regulation of cell cycle process
GO:0048518	0.798	positive regulation of biological process
GO:0140014	0.778	mitotic nuclear division
GO:0048522	0.728	positive regulation of cellular process
GO:0000070	0.728	mitotic sister chromatid segregation
GO:0048523	0.712	negative regulation of cellular process
GO:0051128	0.659	regulation of cellular component organization
GO:0008152	0.658	metabolic process
GO:0051234	0.640	establishment of localization
GO:0060255	0.636	regulation of macromolecule metabolic process
GO:0051171	0.635	regulation of nitrogen compound metabolic process
GO:0080090	0.631	regulation of primary metabolic process
GO:0031323	0.628	regulation of cellular metabolic process
GO:0071704	0.612	organic substance metabolic process
GO:0044238	0.532	primary metabolic process
GO:0006807	0.511	nitrogen compound metabolic process
GO:0044237	0.454	cellular metabolic process
GO:0043170	0.451	macromolecule metabolic process
GO:0010604	0.332	positive regulation of macromolecule metabolic process
GO:0051173	0.331	positive regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0015630	0.997	microtubule cytoskeleton
GO:0016020	0.996	membrane
GO:0005886	0.986	plasma membrane
GO:0043227	0.968	membrane-bounded organelle
GO:0099080	0.943	supramolecular complex
GO:0043231	0.943	intracellular membrane-bounded organelle
GO:0005819	0.900	spindle
GO:0070013	0.897	intracellular organelle lumen
GO:0031981	0.893	nuclear lumen
GO:0099081	0.785	supramolecular polymer
GO:0099512	0.740	supramolecular fiber
GO:0099513	0.725	polymeric cytoskeletal fiber
GO:0005874	0.692	microtubule
GO:0005654	0.665	nucleoplasm
GO:0030496	0.620	midbody
GO:0032991	0.592	protein-containing complex
GO:0051233	0.352	spindle midzone

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.3	0.641	plus-end-directed kinesin ATPase.

[back to server]