StarFunc result for job id Q15063

User Input

>input (836 residues)
MIPFLPMFSLLLLLIVNPINANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTC
KNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDAS
KLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLK
NGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDF
IEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEAL
MKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHL
IDQVLIPDSAKQVIELAGKQQTTFTDLVAQLGLASALRPDGEYTLLAPVNNAFSDDTLSM
DQRLLKLILQNHILKVKVGLNELYNGQILETIGGKQLRVFVYRTAVCIENSCMEKGSKQG
RNGAIHIFREIIKPAEKSLHEKLKQDKRFSTFLSLLEAADLKELLTQPGDWTLFVPTNDA
FKGMTSEEKEILIRDKNALQNIILYHLTPGVFIGKGFEPGVTNILKTTQGSKIFLKEVND
TLLVNELKSKESDIMTTNGVIHVVDKLLYPADTPVGNDQLLEILNKLIKYIQIKFVRGST
FKEIPVTVYTTKIITKVVEPKIKVIEGSLQPIIKTEGPTLTKVKIEGEPEFRLIKEGETI
TEVIHGEPIIKKYTKIIDGVPVEITEKETREERIITGPEIKYTRISTGGGETEETLKKLL
QEEVTKVTKFIEGGDGHLFEDEEIKRLLQGDTPVRKLQANKKVQGSRRRLREGRSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A097BW25	0.749	0.798	0.000	783	0.843	0.900	A0A097BW25.pdb.gz	A0A097BW25_RAT Periostin isoform R1 OS=Rattus norvegicus OX=10116 GN=Postn PE=1 SV=1
2	AFDB:A0A0R4IS83	0.753	0.788	0.000	797	0.535	0.561	A0A0R4IS83.pdb.gz	A0A0R4IS83_DANRE Periostin isoform X1 OS=Danio rerio OX=7955 GN=fa99h07 PE=1 SV=1
3	AFDB:Q62009	0.790	0.788	0.000	838	0.901	0.899	Q62009.pdb.gz	POSTN_MOUSE Periostin OS=Mus musculus OX=10090 GN=Postn PE=1 SV=2
4	AFDB:Q6DMS3	0.743	0.739	0.000	841	0.737	0.732	Q6DMS3.pdb.gz	Q6DMS3_CHICK Periostin OS=Gallus gallus OX=9031 PE=2 SV=1
5	AFDB:A0A0B5JSG0	0.708	0.869	4.686E-84	677	0.370	0.456	A0A0B5JSG0.pdb.gz
6	AFDB:O11780	0.678	0.820	8.531E-84	683	0.359	0.439	O11780.pdb.gz	BGH3_PIG Transforming growth factor-beta-induced protein ig-h3 OS=Sus scrofa OX=9823 GN=TGFBI PE=1 SV=1
7	AFDB:Q86B94	0.401	0.378	8.369E-42	905	0.157	0.145	Q86B94.pdb.gz	Q86B94_DROME FI19380p1 OS=Drosophila melanogaster OX=7227 GN=mfas PE=1 SV=1
8	AFDB:P10674	0.287	0.345	2.631E-30	652	0.141	0.181	P10674.pdb.gz	FAS1_DROME Fasciclin-1 OS=Drosophila melanogaster OX=7227 GN=Fas1 PE=1 SV=1
9	AFDB:F6P8Y7	0.183	0.075	1.424E-29	2543	0.156	0.051	F6P8Y7.pdb.gz	F6P8Y7_DANRE Stabilin 2 OS=Danio rerio OX=7955 GN=si:dkey-207j16.6 PE=1 SV=1
10	AFDB:Q8R4U0	0.180	0.076	4.008E-29	2559	0.176	0.057	Q8R4U0.pdb.gz	STAB2_MOUSE Stabilin-2 OS=Mus musculus OX=10090 GN=Stab2 PE=1 SV=1
11	PDB:1nyoA	0.144	0.669	6.125E-7	163	0.038	0.196	1nyoA.pdb.gz
12	PDB:7lbmr	0.059	0.051	1.886E-1	1034	0.044	0.036	7lbmr.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
13	PDB:2b1oA	0.033	0.095	1.495	212	0.006	0.024	2b1oA.pdb.gz	Solution structures of the adhesion molecule DdCAD-1 reveal new insights into Ca(2+)-dependent cell-cell adhesion
14	PDB:4jd7A	0.052	0.109	1.578	314	0.054	0.143	4jd7A.pdb.gz
15	PDB:4rm8A	0.044	0.068	1.859	368	0.024	0.054	4rm8A.pdb.gz
16	PDB:5apnP	0.046	0.149	1.859	183	0.007	0.033	5apnP.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
17	PDB:4nbbE	0.037	0.255	1.963	114	0.005	0.035	4nbbE.pdb.gz	Structural basis of the divergent oxygenation reactions catalyzed by the rieske nonheme iron oxygenase carbazole 1,9a-dioxygenase.
18	PDB:4v6wCP	0.046	0.143	1.963	185	0.011	0.049	4v6wCP.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:5ondA	0.030	0.144	2.072	135	0.014	0.089	5ondA.pdb.gz	The universally-conserved transcription factor RfaH is recruited to a hairpin structure of the non-template DNA strand.
20	PDB:7pmkR	0.046	0.062	2.189	552	0.013	0.020	7pmkR.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A097BW25	1419	783	0.821	0.876	A0A097BW25_RAT Periostin isoform R1 OS=Rattus norvegicus OX=10116 GN=Postn PE=1 SV=1
2	A0A0G2K692	1486	811	0.852	0.878	A0A0G2K692_RAT Periostin OS=Rattus norvegicus OX=10116 GN=Postn PE=1 SV=1
3	A0A0R4INY2	922	756	0.535	0.591	A0A0R4INY2_DANRE Periostin isoform X5 OS=Danio rerio OX=7955 GN=fa99h07 PE=1 SV=1
4	A0A0R4IPF4	929	785	0.543	0.578	A0A0R4IPF4_DANRE Periostin isoform X2 OS=Danio rerio OX=7955 GN=fa99h07 PE=1 SV=2
5	A0A0R4IS83	927	797	0.541	0.567	A0A0R4IS83_DANRE Periostin isoform X1 OS=Danio rerio OX=7955 GN=fa99h07 PE=1 SV=1
6	A0A8I5Y5Q6	1442	795	0.827	0.869	A0A8I5Y5Q6_RAT Periostin OS=Rattus norvegicus OX=10116 GN=Postn PE=1 SV=1
7	A0A8I5Y6L2	1462	786	0.840	0.893	A0A8I5Y6L2_RAT Periostin OS=Rattus norvegicus OX=10116 GN=Postn PE=1 SV=1
8	A0A8I5ZSM4	589	667	0.347	0.435	A0A8I5ZSM4_RAT Transforming growth factor, beta induced OS=Rattus norvegicus OX=10116 GN=Tgfbi PE=1 SV=1
9	A0A8I6AHK0	1551	838	0.883	0.881	A0A8I6AHK0_RAT Periostin OS=Rattus norvegicus OX=10116 GN=Postn PE=1 SV=1
10	A0A8I6AK89	1517	835	0.867	0.868	A0A8I6AK89_RAT Periostin OS=Rattus norvegicus OX=10116 GN=Postn PE=1 SV=1
11	A0A8I6AMY6	588	670	0.347	0.433	A0A8I6AMY6_RAT Transforming growth factor, beta induced OS=Rattus norvegicus OX=10116 GN=Tgfbi PE=1 SV=1
12	A0JMK0	924	756	0.538	0.595	A0JMK0_DANRE Periostin isoform 1 precursor OS=Danio rerio OX=7955 GN=postn PE=1 SV=1
13	D3ZAF5	1483	810	0.852	0.879	D3ZAF5_RAT Periostin OS=Rattus norvegicus OX=10116 GN=Postn PE=1 SV=1
14	D4A8G5	610	671	0.359	0.447	D4A8G5_RAT Transforming growth factor, beta induced OS=Rattus norvegicus OX=10116 GN=Tgfbi PE=1 SV=3
15	O11780	608	683	0.352	0.430	BGH3_PIG Transforming growth factor-beta-induced protein ig-h3 OS=Sus scrofa OX=9823 GN=TGFBI PE=1 SV=1
16	P82198	609	683	0.355	0.435	BGH3_MOUSE Transforming growth factor-beta-induced protein ig-h3 OS=Mus musculus OX=10090 GN=Tgfbi PE=1 SV=1
17	Q15063	1709	836	1.000	1.000	POSTN_HUMAN Periostin OS=Homo sapiens OX=9606 GN=POSTN PE=1 SV=2
18	Q15582	608	683	0.354	0.433	BGH3_HUMAN Transforming growth factor-beta-induced protein ig-h3 OS=Homo sapiens OX=9606 GN=TGFBI PE=1 SV=1
19	Q62009	1568	838	0.891	0.889	POSTN_MOUSE Periostin OS=Mus musculus OX=10090 GN=Postn PE=1 SV=2
20	Q6DMS3	1292	841	0.744	0.740	Q6DMS3_CHICK Periostin OS=Gallus gallus OX=9031 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02469 Fasciclin	1.8e-102	350.0	Fasciclin domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369071

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346839	0.992	Fibronectin type III domain containing
2	9606.ENSP00000305714	0.983	Bone morphogenetic protein 1
3	9606.ENSP00000297268	0.928	Collagen alpha-2(I) chain
4	9606.ENSP00000304408	0.923	Collagen alpha-1(III) chain
5	9606.ENSP00000225964	0.887	Collagen alpha-1(I) chain
6	9606.ENSP00000364000	0.879	Collagen alpha-2(V) chain
7	9606.ENSP00000052754	0.846	Decorin
8	9606.ENSP00000219070	0.817	72 kDa type IV collagenase
9	9606.ENSP00000266718	0.811	Lumican
10	9606.ENSP00000268603	0.800	Cadherin-11
11	9606.ENSP00000295550	0.782	Collagen alpha-3(VI) chain
12	9606.ENSP00000231061	0.777	SPARC
13	9606.ENSP00000261023	0.768	Integrin alpha-V
14	9606.ENSP00000231004	0.766	Protein-lysine 6-oxidase
15	9606.ENSP00000401645	0.759	Plasminogen activator inhibitor 2
16	9606.ENSP00000325146	0.742	Collagen alpha-1(XII) chain
17	9606.ENSP00000234701	0.739	Calcium-activated chloride channel regulator 1
18	9606.ENSP00000327336	0.738	Biglycan
19	9606.ENSP00000418754	0.738	Inactive tyrosine-protein kinase 7
20	9606.ENSP00000188790	0.723	Prolyl endopeptidase FAP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097367	0.996	carbohydrate derivative binding
GO:1901681	0.995	sulfur compound binding
GO:0008201	0.988	heparin binding
GO:0043167	0.613	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.997	multicellular organismal process
GO:0030334	0.996	regulation of cell migration
GO:0014823	0.995	response to activity
GO:0030155	0.995	regulation of cell adhesion
GO:0120036	0.995	plasma membrane bounded cell projection organization
GO:0071363	0.995	cellular response to growth factor stimulus
GO:0060560	0.995	developmental growth involved in morphogenesis
GO:0032989	0.995	cellular component morphogenesis
GO:0010628	0.995	positive regulation of gene expression
GO:0014070	0.994	response to organic cyclic compound
GO:0034612	0.994	response to tumor necrosis factor
GO:0071310	0.994	cellular response to organic substance
GO:0032990	0.994	cell part morphogenesis
GO:0033993	0.993	response to lipid
GO:0010810	0.993	regulation of cell-substrate adhesion
GO:0071560	0.993	cellular response to transforming growth factor beta stimulus
GO:0003013	0.992	circulatory system process
GO:0000902	0.992	cell morphogenesis
GO:0048666	0.992	neuron development
GO:0030335	0.989	positive regulation of cell migration
GO:0048523	0.987	negative regulation of cellular process
GO:0009628	0.986	response to abiotic stimulus
GO:0051240	0.985	positive regulation of multicellular organismal process
GO:0042060	0.984	wound healing
GO:0010812	0.981	negative regulation of cell-substrate adhesion
GO:0071356	0.981	cellular response to tumor necrosis factor
GO:0001952	0.978	regulation of cell-matrix adhesion
GO:0044344	0.978	cellular response to fibroblast growth factor stimulus
GO:0014911	0.978	positive regulation of smooth muscle cell migration
GO:0009612	0.977	response to mechanical stimulus
GO:0032355	0.977	response to estradiol
GO:1900024	0.976	regulation of substrate adhesion-dependent cell spreading
GO:0032722	0.975	positive regulation of chemokine production
GO:0014850	0.971	response to muscle activity
GO:0031099	0.970	regeneration
GO:0008217	0.965	regulation of blood pressure
GO:1990138	0.965	neuron projection extension
GO:0042246	0.948	tissue regeneration
GO:0070482	0.937	response to oxygen levels
GO:0036293	0.871	response to decreased oxygen levels
GO:0007154	0.619	cell communication
GO:0001666	0.577	response to hypoxia
GO:0071496	0.336	cellular response to external stimulus
GO:0009991	0.311	response to extracellular stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005615	0.999	extracellular space
GO:0071944	0.908	cell periphery
GO:0030054	0.866	cell junction
GO:0031594	0.806	neuromuscular junction
GO:0043227	0.805	membrane-bounded organelle
GO:0043231	0.781	intracellular membrane-bounded organelle
GO:0012505	0.592	endomembrane system
GO:0062023	0.426	collagen-containing extracellular matrix
GO:0070013	0.380	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]