StarFunc result for job id Q15070

User Input

>input (435 residues)
MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCRPHYLFLAASG
PRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETADVVQTAAEQSFAELGLGSYT
PVGLIQNLLEFMHVDLGLPWWGAIAACTVFARCLIFPLIVTGQREAARIHNHLPEIQKFS
SRIREAKLAGDHIEYYKASSEMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANL
PVPSLQTGGLWWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMM
PLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVHDLDKLPPREG
FLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQTFTHNPLLQPGKDNPPNIPSS
SSKPKSKYPWHDTLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2M1J6	0.701	0.617	1.910E-51	496	1.000	0.877	Q2M1J6.pdb.gz	Q2M1J6_HUMAN Oxidase (Cytochrome c) assembly 1-like OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=1
2	AFDB:Q8BGA9	0.703	0.706	2.091E-43	433	0.743	0.746	Q8BGA9.pdb.gz	OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus OX=10090 GN=Oxa1l PE=1 SV=1
3	AFDB:Q9Y171	0.608	0.600	1.006E-26	441	0.329	0.324	Q9Y171.pdb.gz	Q9Y171_DROME BcDNA.GH02220 OS=Drosophila melanogaster OX=7227 GN=OXA1L PE=2 SV=1
4	AFDB:O43092	0.522	0.554	4.110E-19	409	0.260	0.276	O43092.pdb.gz	OXA12_SCHPO Mitochondrial inner membrane protein oxa1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oxa102 PE=2 SV=2
5	AFDB:P39952	0.565	0.608	1.356E-17	402	0.255	0.276	P39952.pdb.gz	OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OXA1 PE=1 SV=1
6	AFDB:O14300	0.550	0.630	1.825E-16	374	0.205	0.238	O14300.pdb.gz	OXA11_SCHPO Mitochondrial inner membrane protein oxa1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oxa101 PE=2 SV=1
7	AFDB:O02207	0.513	0.595	6.695E-16	366	0.209	0.249	O02207.pdb.gz	O02207_CAEEL OXA mitochondrial inner membrane insertase homolog OS=Caenorhabditis elegans OX=6239 GN=oxa-1 PE=1 SV=2
8	AFDB:Q8N8Q8	0.466	0.598	1.043E-12	333	0.184	0.240	Q8N8Q8.pdb.gz	COX18_HUMAN Cytochrome c oxidase assembly protein COX18, mitochondrial OS=Homo sapiens OX=9606 GN=COX18 PE=1 SV=1
9	AFDB:Q385F4	0.480	0.498	3.700E-10	418	0.168	0.175	Q385F4.pdb.gz	Q385F4_TRYB2 60Kd inner membrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4020 PE=4 SV=1
10	AFDB:O94587	0.399	0.804	1.718E-7	202	0.120	0.257	O94587.pdb.gz	COX18_SCHPO Cytochrome c oxidase assembly protein cox18, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox18 PE=3 SV=1
11	PDB:6al2A	0.382	0.346	1.786E-7	484	0.115	0.103	6al2A.pdb.gz
12	PDB:5mg3C	0.323	0.311	7.013E-3	455	0.122	0.116	5mg3C.pdb.gz
13	PDB:5m5hA	0.252	0.748	3.521E-2	132	0.087	0.288	5m5hA.pdb.gz
14	PDB:6zm5u	0.074	0.370	6.897E-2	51	0.115	0.980	6zm5u.pdb.gz	Mechanism of membrane-tethered mitochondrial protein synthesis.
15	PDB:6mj2A	0.097	0.045	6.783E-1	1337	0.117	0.038	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
16	PDB:5kucA	0.160	0.170	1.215	402	0.085	0.092	5kucA.pdb.gz
17	PDB:4jc6A	0.168	0.234	1.329	252	0.064	0.111	4jc6A.pdb.gz
18	PDB:7s5xE	0.111	0.042	1.520	1412	0.087	0.027	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
19	PDB:2b6pA	0.133	0.191	1.739	261	0.074	0.123	2b6pA.pdb.gz
20	PDB:5nx7A	0.100	0.123	1.739	308	0.069	0.097	5nx7A.pdb.gz	Structural Basis of Catalysis in the Bacterial Monoterpene Synthases Linalool Synthase and 1,8-Cineole Synthase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X0L7	0.0	892	435	0.998	0.998	A0A087X0L7_HUMAN OXA1L mitochondrial inner membrane protein OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=1
2	J3KNA0	0.0	890	495	0.998	0.877	J3KNA0_HUMAN OXA1L mitochondrial inner membrane protein OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=1
3	Q15070	0.0	894	435	1.000	1.000	OXA1L_HUMAN Mitochondrial inner membrane protein OXA1L OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=3
4	Q2M1J6	0.0	887	496	1.000	0.877	Q2M1J6_HUMAN Oxidase (Cytochrome c) assembly 1-like OS=Homo sapiens OX=9606 GN=OXA1L PE=1 SV=1
5	Q8BGA9	0.0	645	433	0.740	0.744	OXA1L_MOUSE Mitochondrial inner membrane protein OXA1L OS=Mus musculus OX=10090 GN=Oxa1l PE=1 SV=1
6	Q9Y171	2.59e-94	293	441	0.287	0.283	Q9Y171_DROME BcDNA.GH02220 OS=Drosophila melanogaster OX=7227 GN=OXA1L PE=2 SV=1
7	P39952	3.76e-44	160	402	0.271	0.294	OXA1_YEAST Mitochondrial inner membrane protein OXA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OXA1 PE=1 SV=1
8	O43092	9.22e-43	157	409	0.189	0.200	OXA12_SCHPO Mitochondrial inner membrane protein oxa1-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oxa102 PE=2 SV=2
9	Q42191	2.32e-41	154	429	0.198	0.200	OXA1_ARATH Mitochondrial inner membrane protein OXA1 OS=Arabidopsis thaliana OX=3702 GN=OXA1 PE=2 SV=2
10	O14300	4.17e-36	138	374	0.186	0.217	OXA11_SCHPO Mitochondrial inner membrane protein oxa1-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=oxa101 PE=2 SV=1
11	O02207	6.45e-33	129	366	0.195	0.232	O02207_CAEEL OXA mitochondrial inner membrane insertase homolog OS=Caenorhabditis elegans OX=6239 GN=oxa-1 PE=1 SV=2
12	Q8N8Q8	1.31e-21	97.4	333	0.156	0.204	COX18_HUMAN Cytochrome c oxidase assembly protein COX18, mitochondrial OS=Homo sapiens OX=9606 GN=COX18 PE=1 SV=1
13	Q8VC74	1.24e-19	91.7	331	0.152	0.199	COX18_MOUSE Cytochrome c oxidase assembly protein COX18, mitochondrial OS=Mus musculus OX=10090 GN=Cox18 PE=1 SV=5
14	P25714	1.56e-09	62.4	548	0.120	0.095	YIDC_ECOLI Membrane protein insertase YidC OS=Escherichia coli (strain K12) OX=83333 GN=yidC PE=1 SV=2
15	O94587	2.76e-09	58.9	202	0.126	0.272	COX18_SCHPO Cytochrome c oxidase assembly protein cox18, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox18 PE=3 SV=1
16	Q0WUC5	3.00e-09	61.2	566	0.117	0.090	ALB33_ARATH ALBINO3-like protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ALB3L3 PE=1 SV=1
17	Q385F4	1.68e-08	58.5	418	0.166	0.172	Q385F4_TRYB2 60Kd inner membrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4020 PE=4 SV=1
18	Q38DZ8	3.01e-08	57.8	424	0.087	0.090	Q38DZ8_TRYB2 60Kd inner membrane protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1580 PE=4 SV=1
19	Q8L718	2.42e-04	45.8	525	0.126	0.105	ALB32_ARATH ALBINO3-like protein 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ALB3L2 PE=2 SV=2
20	P53239	0.065	37.7	316	0.085	0.117	COX18_YEAST Cytochrome c oxidase assembly protein COX18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COX18 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02096 60KD_IMP	2.8e-18	77.9	60Kd inner membrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483491

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253099	0.983	Mitochondrial ribosomal protein L4
2	9606.ENSP00000264995	0.955	Mitochondrial ribosomal protein L3
3	9606.ENSP00000279242	0.952	Mitochondrial ribosomal protein L49
4	9606.ENSP00000229238	0.951	Mitochondrial ribosomal protein L51
5	9606.ENSP00000308717	0.948	Mitochondrial ribosomal protein L48
6	9606.ENSP00000341082	0.947	Mitochondrial ribosomal protein L20
7	9606.ENSP00000354632	0.944	ATP synthase subunit a
8	9606.ENSP00000417602	0.940	Belongs to the universal ribosomal protein uL29 family.
9	9606.ENSP00000484903	0.931	Mitochondrial ribosomal protein L45
10	9606.ENSP00000312311	0.926	Mitochondrial ribosomal protein L46
11	9606.ENSP00000288937	0.922	Mitochondrial ribosomal protein L17
12	9606.ENSP00000410339	0.915	Mitochondrial import receptor subunit TOM40 homolog
13	9606.ENSP00000301585	0.911	Peptidyl-tRNA hydrolase ICT1, mitochondrial
14	9606.ENSP00000308117	0.908	Endosialin
15	9606.ENSP00000306548	0.902	Mitochondrial ribosomal protein L13
16	9606.ENSP00000333401	0.895	Mitochondrial ribosomal protein L40
17	9606.ENSP00000406327	0.890	Cytochrome c oxidase protein 20 homolog
18	9606.ENSP00000333837	0.887	39S ribosomal protein L12, mitochondrial
19	9606.ENSP00000354580	0.886	Mitochondrial ribosomal protein L21
20	9606.ENSP00000356256	0.885	Mitochondrial import inner membrane translocase subunit Tim17-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0043021	0.437	ribonucleoprotein complex binding
GO:0043022	0.425	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0044237	0.991	cellular metabolic process
GO:0006091	0.982	generation of precursor metabolites and energy
GO:0065007	0.979	biological regulation
GO:0045333	0.971	cellular respiration
GO:0033108	0.961	mitochondrial respiratory chain complex assembly
GO:0065009	0.960	regulation of molecular function
GO:0051259	0.954	protein complex oligomerization
GO:0050790	0.944	regulation of catalytic activity
GO:0044092	0.944	negative regulation of molecular function
GO:0010257	0.940	NADH dehydrogenase complex assembly
GO:0043462	0.939	regulation of ATP-dependent activity
GO:0051341	0.932	regulation of oxidoreductase activity
GO:0032780	0.774	negative regulation of ATP-dependent activity
GO:0043086	0.765	negative regulation of catalytic activity
GO:0009060	0.583	aerobic respiration
GO:0051262	0.490	protein tetramerization
GO:0032981	0.419	mitochondrial respiratory chain complex I assembly
GO:0051354	0.409	negative regulation of oxidoreductase activity
GO:0051179	0.300	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.988	membrane
GO:0031090	0.959	organelle membrane
GO:0070013	0.953	intracellular organelle lumen
GO:0031966	0.921	mitochondrial membrane
GO:0032991	0.895	protein-containing complex
GO:0005743	0.888	mitochondrial inner membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]