StarFunc result for job id Q15075

User Input

>input (1411 residues)
MLRRILQRTPGRVGSQGSDLDSSATPINTVDVNNESSSEGFICPQCMKSLGSADELFKHY
EAVHDAGNDSGHGGESNLALKRDDVTLLRQEVQDLQASLKEEKWYSEELKKELEKYQGLQ
QQEAKPDGLVTDSSAELQSLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYD
EERSLREAAEQKVTRLTEELNKEATVIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNM
TLERERESEKLKDECKKLQSQYASSEATISQLRSELAKGPQEVAVYVQELQKLKSSVNEL
TQKNQTLTENLLKKEQDYTKLEEKHNEESVSKKNIQATLHQKDLDCQQLQSRLSASETSL
HRIHVELSEKGEATQKLKEELSEVETKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLH
SKLLETERQLGEAHGRLKEQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQ
HQLDKTKQQHQEQQALQQSTTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENIS
LLEKEREDLYAKIQAGEGETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHD
QVQEQKAHLRAAQDRVLSLETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTA
QRADLQNHLDTAQNALQDKQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKYLS
LEQKTEELEGQIKKLEADSLEVKASKEQALQDLQQQRQLNTDLELRATELSKQLEMEKEI
VSSTRLDLQKKSEALESIKQKLTKQEEEKKILKQDFETLSQETKIQHEELNNRIQTTVTE
LQKVKMEKEALMTELSTVKDKLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQ
LQVQMENTLKEQKELKKSLEKEKEASHQLKLELNSMQEQLIQAQNTLKQNEKEEQQLQGN
INELKQSSEQKKKQIEALQGELKIAVLQKTELENKLQQQLTQAAQELAAEKEKISVLQNN
YEKSQETFKQLQSDFYGRESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQEL
KTAKATLEQDSAKKEQQLQERCKALQDIQKEKSLKEKELVNEKSKLAEIEEIKCRQEKEI
TKLNEELKSHKLESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEKRNQQILKDQV
KKEEEELKKEFIEKEAKLHSEIKEKEVGMKKHEENEAKLTMQITALNENLGTVKKEWQSS
QRRVSELEKQTDDLRGEIAVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKL
DNTTAAVQELGRENQSLQIKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNI
FCAECSAKNALTPSSKKPVRVCDACFNDLQG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15075	1.000	1.000	0.000	1411	1.000	1.000	Q15075.pdb.gz	EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2
2	AFDB:Q8BL66	0.234	0.234	0.000	1411	0.859	0.859	Q8BL66.pdb.gz	EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus OX=10090 GN=Eea1 PE=1 SV=2
3	AFDB:G5ED80	0.127	0.145	3.836E-17	1205	0.230	0.269	G5ED80.pdb.gz	G5ED80_CAEEL EEA1 OS=Caenorhabditis elegans OX=6239 GN=eea-1 PE=1 SV=1
4	AFDB:Q8WXA3	0.085	0.185	5.139E-7	606	0.068	0.158	Q8WXA3.pdb.gz	RUFY2_HUMAN RUN and FYVE domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RUFY2 PE=1 SV=3
5	AFDB:Q8IMP2	0.087	0.148	7.955E-6	729	0.064	0.123	Q8IMP2.pdb.gz	Q8IMP2_DROME LD28220p OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
6	AFDB:Q8BIJ7	0.112	0.201	9.631E-6	712	0.069	0.136	Q8BIJ7.pdb.gz	RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rufy1 PE=1 SV=1
7	AFDB:A0A0B4LHR8	0.077	0.115	1.603E-5	877	0.065	0.105	A0A0B4LHR8.pdb.gz	A0A0B4LHR8_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
8	AFDB:Q9W2M0	0.101	0.196	1.603E-5	647	0.079	0.172	Q9W2M0.pdb.gz	Q9W2M0_DROME LD23155p OS=Drosophila melanogaster OX=7227 GN=Rbpn-5 PE=1 SV=2
9	AFDB:Q19088	0.103	0.275	1.924E-4	414	0.057	0.193	Q19088.pdb.gz	Q19088_CAEEL FYVE-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rabn-5 PE=1 SV=1
10	AFDB:Q9BQS8	0.082	0.079	1.386E-3	1478	0.145	0.139	Q9BQS8.pdb.gz	FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3
11	PDB:4kfzB	0.023	0.185	4.469E-1	148	0.008	0.074	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:4kblA	0.028	0.083	7.439E-1	395	0.009	0.030	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
13	PDB:7sqkE	0.076	0.148	1.499	610	0.026	0.061	7sqkE.pdb.gz
14	PDB:5z8lA	0.029	0.169	2.062	204	0.007	0.049	5z8lA.pdb.gz	EBS is a bivalent histone reader that regulates floral phase transition in Arabidopsis.
15	PDB:7od1A	0.031	0.083	2.835	430	0.008	0.026	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
16	PDB:7oniH	0.029	0.084	3.022	380	0.008	0.029	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:7c4jH	0.061	0.306	3.220	242	0.018	0.103	7c4jH.pdb.gz
18	PDB:1jeqA	0.021	0.043	3.432	548	0.003	0.007	1jeqA.pdb.gz
19	PDB:6muuA	0.028	0.049	3.899	780	0.007	0.013	6muuA.pdb.gz	Type III-A CRISPR-Cas Csm Complexes: Assembly, Periodic RNA Cleavage, DNase Activity Regulation, and Autoimmunity.
20	PDB:3ojaA	0.046	0.114	4.155	482	0.023	0.066	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K051	0.0	2266	1407	0.850	0.853	A0A0G2K051_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=2
2	A0A8I5ZV67	0.0	2279	1411	0.855	0.855	A0A8I5ZV67_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=4 SV=1
3	A0A8I6A8E0	0.0	2199	1431	0.840	0.828	A0A8I6A8E0_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=1
4	A0A8I6AIH5	0.0	1995	1312	0.765	0.823	A0A8I6AIH5_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=1
5	A0A8I6AIN6	0.0	2256	1453	0.855	0.831	A0A8I6AIN6_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=1
6	F1LUA1	0.0	2240	1450	0.850	0.828	F1LUA1_RAT Early endosome antigen 1 OS=Rattus norvegicus OX=10116 GN=Eea1 PE=1 SV=2
7	Q05D76	0.0	621	311	0.215	0.974	Q05D76_HUMAN EEA1 protein (Fragment) OS=Homo sapiens OX=9606 GN=EEA1 PE=2 SV=1
8	Q15075	0.0	2746	1411	1.000	1.000	EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2
9	Q8BL66	0.0	2251	1411	0.860	0.860	EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus OX=10090 GN=Eea1 PE=1 SV=2
10	Q5FC45	6.30e-34	144	1203	0.054	0.063	Q5FC45_CAEEL FYVE-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eea-1 PE=1 SV=1
11	G5ED80	6.59e-34	144	1205	0.054	0.063	G5ED80_CAEEL EEA1 OS=Caenorhabditis elegans OX=6239 GN=eea-1 PE=1 SV=1
12	Q8BIJ7	2.25e-17	90.5	712	0.043	0.084	RUFY1_MOUSE RUN and FYVE domain-containing protein 1 OS=Mus musculus OX=10090 GN=Rufy1 PE=1 SV=1
13	Q96T51	1.40e-16	87.8	708	0.031	0.062	RUFY1_HUMAN RUN and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RUFY1 PE=1 SV=2
14	Q8WXA3	1.43e-16	87.4	606	0.027	0.063	RUFY2_HUMAN RUN and FYVE domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RUFY2 PE=1 SV=3
15	Q9W2M0	2.75e-14	80.1	647	0.025	0.054	Q9W2M0_DROME LD23155p OS=Drosophila melanogaster OX=7227 GN=Rbpn-5 PE=1 SV=2
16	Q9BQS8	7.29e-13	76.3	1478	0.025	0.024	FYCO1_HUMAN FYVE and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FYCO1 PE=1 SV=3
17	Q86P45	1.60e-12	73.9	441	0.020	0.063	Q86P45_DROME SD23787p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CG6001 PE=2 SV=1
18	Q8IMP2	3.16e-12	73.6	729	0.020	0.038	Q8IMP2_DROME LD28220p OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
19	A0A0B4LHR8	5.39e-12	73.2	877	0.020	0.032	A0A0B4LHR8_DROME Uncharacterized protein, isoform G OS=Drosophila melanogaster OX=7227 GN=CG14261 PE=1 SV=1
20	Q19088	4.21e-11	69.3	414	0.033	0.111	Q19088_CAEEL FYVE-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rabn-5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10186 ATG14	1.1	19.8	Vacuolar sorting 38 and autophagy-related subunit 14
2	PF01363 FYVE	1.2e-16	71.9	FYVE zinc finger
3	PF01485 IBR	3.7e+02	12.6	IBR domain, a half RING-finger domain
4	PF13894 zf-C2H2_4	6.5e+02	12.7	C2H2-type zinc finger
5	PF17283 Zn_ribbon_SprT	9.8e+02	11.2	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317955

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000273047	0.999	Ras-related protein Rab-5A
2	9606.ENSP00000447053	0.989	Ras-related protein Rab-5C
3	9606.ENSP00000353444	0.982	Ras-related protein Rab-5B
4	9606.ENSP00000258301	0.977	Syntaxin-6
5	9606.ENSP00000262039	0.976	Phosphatidylinositol 3-kinase catalytic subunit type 3
6	9606.ENSP00000333298	0.949	Lysosome-associated membrane glycoprotein 1
7	9606.ENSP00000265062	0.932	Ras-related protein Rab-7a
8	9606.ENSP00000479762	0.901	Ras-related protein Rab-7b
9	9606.ENSP00000370208	0.892	RAB guanine nucleotide exchange factor 1
10	9606.ENSP00000261890	0.878	Ras-related protein Rab-11A
11	9606.ENSP00000445408	0.865	Rab GTPase-binding effector protein 1
12	9606.ENSP00000408411	0.855	Lysosome-associated membrane glycoprotein 2
13	9606.ENSP00000269571	0.850	Receptor tyrosine-protein kinase erbB-2
14	9606.ENSP00000244040	0.837	Ras-related protein Rab-22A
15	9606.ENSP00000386443	0.833	Trans-Golgi network integral membrane protein 2
16	9606.ENSP00000299138	0.831	Vacuolar protein sorting-associated protein 35
17	9606.ENSP00000347379	0.824	Occludin
18	9606.ENSP00000243924	0.816	Elafin
19	9606.ENSP00000357836	0.816	Sorting nexin-27
20	9606.ENSP00000355651	0.808	Ras-related protein Rab-4A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.654	identical protein binding
GO:0035091	0.588	phosphatidylinositol binding
GO:0005545	0.568	1-phosphatidylinositol binding
GO:0030742	0.543	GTP-dependent protein binding
GO:0043167	0.531	ion binding
GO:0046983	0.518	protein dimerization activity
GO:0042803	0.514	protein homodimerization activity
GO:0008270	0.433	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0051234	0.975	establishment of localization
GO:0006810	0.957	transport
GO:0051641	0.950	cellular localization
GO:0016043	0.936	cellular component organization
GO:0016192	0.901	vesicle-mediated transport
GO:0051649	0.885	establishment of localization in cell
GO:0046907	0.879	intracellular transport
GO:0065007	0.860	biological regulation
GO:0006996	0.845	organelle organization
GO:0050794	0.819	regulation of cellular process
GO:0050896	0.538	response to stimulus
GO:0016197	0.400	endosomal transport
GO:0051716	0.361	cellular response to stimulus
GO:0061024	0.315	membrane organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005768	1.000	endosome
GO:0005829	0.947	cytosol
GO:0071944	0.912	cell periphery
GO:0031090	0.760	organelle membrane
GO:0055037	0.681	recycling endosome
GO:0005769	0.668	early endosome
GO:0098588	0.454	bounding membrane of organelle
GO:0005886	0.442	plasma membrane
GO:0070013	0.418	intracellular organelle lumen
GO:0019898	0.365	extrinsic component of membrane
GO:0019897	0.355	extrinsic component of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]