StarFunc result for job id Q15077

User Input

>input (328 residues)
MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR
TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI
SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL
SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM
AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL
FYFTQKKFRRRPHELLQKLTAKWQRQGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15077	1.000	1.000	6.770E-47	328	1.000	1.000	Q15077.pdb.gz	P2RY6_HUMAN P2Y purinoceptor 6 OS=Homo sapiens OX=9606 GN=P2RY6 PE=1 SV=1
2	AFDB:Q63371	0.946	0.946	2.578E-40	328	0.875	0.875	Q63371.pdb.gz	P2RY6_RAT P2Y purinoceptor 6 OS=Rattus norvegicus OX=10116 GN=P2ry6 PE=2 SV=1
3	AFDB:P41231	0.844	0.738	1.490E-21	377	0.390	0.340	P41231.pdb.gz	P2RY2_HUMAN P2Y purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RY2 PE=1 SV=4
4	AFDB:P41232	0.828	0.730	3.708E-21	374	0.381	0.334	P41232.pdb.gz	P2RY2_RAT P2Y purinoceptor 2 OS=Rattus norvegicus OX=10116 GN=P2ry2 PE=2 SV=2
5	AFDB:O35811	0.852	0.777	6.809E-21	361	0.409	0.371	O35811.pdb.gz	P2RY4_RAT P2Y purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2ry4 PE=2 SV=1
6	AFDB:P47900	0.851	0.753	4.038E-20	373	0.351	0.308	P47900.pdb.gz	P2RY1_HUMAN P2Y purinoceptor 1 OS=Homo sapiens OX=9606 GN=P2RY1 PE=1 SV=1
7	AFDB:P51582	0.868	0.784	4.217E-20	365	0.402	0.362	P51582.pdb.gz	P2RY4_HUMAN P2Y purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RY4 PE=1 SV=1
8	AFDB:B2R986	0.848	0.826	2.007E-17	337	0.299	0.291	B2R986.pdb.gz	B2R986_HUMAN HCG1774561 OS=Homo sapiens OX=9606 GN=hCG_1774561 PE=2 SV=1
9	AFDB:Q8BLG2	0.818	0.730	4.199E-17	370	0.293	0.259	Q8BLG2.pdb.gz	LPAR4_MOUSE Lysophosphatidic acid receptor 4 OS=Mus musculus OX=10090 GN=Lpar4 PE=2 SV=2
10	AFDB:Q920A1	0.819	0.866	6.769E-17	309	0.271	0.288	Q920A1.pdb.gz	CLTR2_MOUSE Cysteinyl leukotriene receptor 2 OS=Mus musculus OX=10090 GN=Cysltr2 PE=2 SV=2
11	PDB:6ibbA	0.755	0.818	3.132E-14	301	0.284	0.309	6ibbA.pdb.gz	Structural basis of species-selective antagonist binding to the succinate receptor.
12	PDB:5xszA	0.715	0.534	2.517E-13	448	0.277	0.203	5xszA.pdb.gz
13	PDB:7eibA	0.772	0.852	4.238E-13	295	0.238	0.264	7eibA.pdb.gz	Molecular basis for kinin selectivity and activation of the human bradykinin receptors.
14	PDB:7vl9R	0.789	0.852	4.828E-13	302	0.238	0.258	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
15	PDB:7wicR	0.709	0.797	1.255E-12	288	0.259	0.295	7wicR.pdb.gz	Structures of the endogenous peptide- and selective non-peptide agonist-bound SSTR2 signaling complexes.
16	PDB:7f6hA	0.796	0.851	1.429E-12	305	0.235	0.252	7f6hA.pdb.gz	Cryo-EM structures of human bradykinin receptor-G q proteins complexes.
17	PDB:8ef5M	0.732	0.824	1.429E-12	288	0.238	0.271	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
18	PDB:7f1qR	0.734	0.662	2.207E-12	367	0.198	0.177	7f1qR.pdb.gz
19	PDB:6lfmR	0.761	0.808	3.880E-12	307	0.256	0.274	6lfmR.pdb.gz	Structural basis of CXC chemokine receptor 2 activation and signalling.
20	PDB:7wq3R	0.707	0.794	3.880E-12	289	0.238	0.270	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15077	0.0	667	328	1.000	1.000	P2RY6_HUMAN P2Y purinoceptor 6 OS=Homo sapiens OX=9606 GN=P2RY6 PE=1 SV=1
2	Q63371	0.0	551	328	0.875	0.875	P2RY6_RAT P2Y purinoceptor 6 OS=Rattus norvegicus OX=10116 GN=P2ry6 PE=2 SV=1
3	Q9ERK9	0.0	559	328	0.866	0.866	P2RY6_MOUSE P2Y purinoceptor 6 OS=Mus musculus OX=10090 GN=P2ry6 PE=2 SV=1
4	O35811	3.72e-69	221	361	0.415	0.377	P2RY4_RAT P2Y purinoceptor 4 OS=Rattus norvegicus OX=10116 GN=P2ry4 PE=2 SV=1
5	Q9JJS7	9.28e-69	220	361	0.415	0.377	P2RY4_MOUSE P2Y purinoceptor 4 OS=Mus musculus OX=10090 GN=P2ry4 PE=2 SV=1
6	P51582	1.00e-66	215	365	0.399	0.359	P2RY4_HUMAN P2Y purinoceptor 4 OS=Homo sapiens OX=9606 GN=P2RY4 PE=1 SV=1
7	P41231	2.75e-66	214	377	0.405	0.353	P2RY2_HUMAN P2Y purinoceptor 2 OS=Homo sapiens OX=9606 GN=P2RY2 PE=1 SV=4
8	P41232	4.43e-64	209	374	0.396	0.348	P2RY2_RAT P2Y purinoceptor 2 OS=Rattus norvegicus OX=10116 GN=P2ry2 PE=2 SV=2
9	P35383	2.38e-62	204	373	0.387	0.340	P2RY2_MOUSE P2Y purinoceptor 2 OS=Mus musculus OX=10090 GN=P2ry2 PE=1 SV=1
10	P59902	3.60e-59	196	373	0.351	0.308	P2RY1_CAVPO P2Y purinoceptor 1 OS=Cavia porcellus OX=10141 GN=P2RY1 PE=2 SV=1
11	P49651	1.03e-58	195	373	0.354	0.311	P2RY1_RAT P2Y purinoceptor 1 OS=Rattus norvegicus OX=10116 GN=P2ry1 PE=2 SV=1
12	P49650	1.53e-57	192	373	0.351	0.308	P2RY1_MOUSE P2Y purinoceptor 1 OS=Mus musculus OX=10090 GN=P2ry1 PE=2 SV=1
13	P47900	2.48e-57	191	373	0.360	0.316	P2RY1_HUMAN P2Y purinoceptor 1 OS=Homo sapiens OX=9606 GN=P2RY1 PE=1 SV=1
14	Q99JA4	4.11e-44	156	352	0.296	0.276	CLTR1_MOUSE Cysteinyl leukotriene receptor 1 OS=Mus musculus OX=10090 GN=Cysltr1 PE=1 SV=1
15	B2R986	6.40e-44	155	337	0.287	0.279	B2R986_HUMAN HCG1774561 OS=Homo sapiens OX=9606 GN=hCG_1774561 PE=2 SV=1
16	Q96P68	6.40e-44	155	337	0.287	0.279	OXGR1_HUMAN 2-oxoglutarate receptor 1 OS=Homo sapiens OX=9606 GN=OXGR1 PE=2 SV=1
17	Q8BMC0	5.78e-43	153	344	0.296	0.282	LPAR6_MOUSE Lysophosphatidic acid receptor 6 OS=Mus musculus OX=10090 GN=Lpar6 PE=1 SV=1
18	Q8BLG2	4.12e-42	151	370	0.305	0.270	LPAR4_MOUSE Lysophosphatidic acid receptor 4 OS=Mus musculus OX=10090 GN=Lpar4 PE=2 SV=2
19	Q08BG4	6.09e-42	150	357	0.299	0.275	Q08BG4_DANRE Lysophosphatidic acid receptor 6 OS=Danio rerio OX=7955 GN=zgc:153784 PE=1 SV=1
20	P43657	8.31e-42	150	344	0.293	0.279	LPAR6_HUMAN Lysophosphatidic acid receptor 6 OS=Homo sapiens OX=9606 GN=LPAR6 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.8e-41	153.8	7 transmembrane receptor (rhodopsin family)
2	PF10323 7TM_GPCR_Srv	6.9	17.5	Serpentine type 7TM GPCR chemoreceptor Srv
3	PF16192 PMT_4TMC	57	14.7	C-terminal four TMM region of protein-O-mannosyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480966

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225538	0.872	P2X purinoceptor 1
2	9606.ENSP00000353032	0.861	P2X purinoceptor 4
3	9606.ENSP00000263314	0.797	P2X purinoceptor 3
4	9606.ENSP00000343339	0.792	P2X purinoceptor 2
5	9606.ENSP00000416193	0.792	P2X purinoceptor 6
6	9606.ENSP00000330696	0.783	P2X purinoceptor 7
7	9606.ENSP00000225328	0.773	P2X purinoceptor 5
8	9606.ENSP00000358730	0.630	Transmembrane domain-containing protein TMIGD3
9	9606.ENSP00000356205	0.619	Adenosine receptor A1
10	9606.ENSP00000304501	0.611	Adenosine receptor A2b
11	9606.ENSP00000336630	0.608	Adenosine A2a receptor
12	9606.ENSP00000227638	0.596	Pannexin-1
13	9606.ENSP00000360250	0.567	Ectonucleoside triphosphate diphosphohydrolase 1
14	9606.ENSP00000347213	0.563	Ectonucleoside triphosphate diphosphohydrolase 2
15	9606.ENSP00000360561	0.512	Ectonucleoside triphosphate diphosphohydrolase 8
16	9606.ENSP00000286548	0.506	Guanine nucleotide-binding protein G(q) subunit alpha
17	9606.ENSP00000323872	0.502	Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	1.000	binding
GO:0016502	1.000	nucleotide receptor activity
GO:0004930	1.000	G protein-coupled receptor activity
GO:0005515	0.994	protein binding
GO:0008528	0.959	G protein-coupled peptide receptor activity
GO:0001614	0.891	purinergic nucleotide receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.985	response to stimulus
GO:0009987	0.985	cellular process
GO:0051716	0.984	cellular response to stimulus
GO:0042221	0.982	response to chemical
GO:0050794	0.976	regulation of cellular process
GO:0009719	0.973	response to endogenous stimulus
GO:0010033	0.972	response to organic substance
GO:1901700	0.966	response to oxygen-containing compound
GO:0070887	0.915	cellular response to chemical stimulus
GO:1903169	0.902	regulation of calcium ion transmembrane transport
GO:0048518	0.898	positive regulation of biological process
GO:0007165	0.895	signal transduction
GO:1901701	0.892	cellular response to oxygen-containing compound
GO:0071495	0.879	cellular response to endogenous stimulus
GO:0071310	0.875	cellular response to organic substance
GO:0046683	0.871	response to organophosphorus
GO:1901699	0.866	cellular response to nitrogen compound
GO:1904427	0.866	positive regulation of calcium ion transmembrane transport
GO:0044093	0.863	positive regulation of molecular function
GO:0071407	0.854	cellular response to organic cyclic compound
GO:0051282	0.843	regulation of sequestering of calcium ion
GO:2001259	0.784	positive regulation of cation channel activity
GO:0051279	0.768	regulation of release of sequestered calcium ion into cytosol
GO:0051281	0.749	positive regulation of release of sequestered calcium ion into cytosol
GO:0010243	0.747	response to organonitrogen compound
GO:1901019	0.719	regulation of calcium ion transmembrane transporter activity
GO:0051179	0.663	localization
GO:0006810	0.648	transport
GO:0014074	0.580	response to purine-containing compound
GO:0032501	0.531	multicellular organismal process
GO:0019222	0.472	regulation of metabolic process
GO:0048583	0.464	regulation of response to stimulus
GO:1901021	0.432	positive regulation of calcium ion transmembrane transporter activity
GO:0009893	0.430	positive regulation of metabolic process
GO:0048519	0.381	negative regulation of biological process
GO:0031323	0.344	regulation of cellular metabolic process
GO:0080090	0.342	regulation of primary metabolic process
GO:0071417	0.318	cellular response to organonitrogen compound
GO:0007186	0.316	G protein-coupled receptor signaling pathway
GO:0048584	0.314	positive regulation of response to stimulus
GO:0060255	0.309	regulation of macromolecule metabolic process
GO:0051239	0.307	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]