StarFunc result for job id Q15078

User Input

>input (307 residues)
MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHSIISVLPWKRIVAVSA
KKKNSKKVQPNSSYQNNITHLNNENLKKSLSCANLSTFAQPPPAQPPAPPASQLSGSQTG
GSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRS
VDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNE
ISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKR
LLLGLDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P61809	0.840	0.840	3.562E-39	307	0.984	0.984	P61809.pdb.gz	CD5R1_MOUSE Cyclin-dependent kinase 5 activator 1 OS=Mus musculus OX=10090 GN=Cdk5r1 PE=1 SV=1
2	AFDB:Q6DGQ7	0.645	0.639	1.712E-32	310	0.801	0.794	Q6DGQ7.pdb.gz
3	AFDB:B3DH98	0.694	0.696	2.942E-29	306	0.651	0.654	B3DH98.pdb.gz	B3DH98_DANRE Cyclin-dependent kinase 5 activator OS=Danio rerio OX=7955 GN=LOC568402 PE=2 SV=1
4	AFDB:Q568S1	0.535	0.534	4.127E-22	308	0.541	0.539	Q568S1.pdb.gz	Q568S1_DANRE Cyclin-dependent kinase 5 activator OS=Danio rerio OX=7955 GN=zgc:110126 PE=2 SV=1
5	AFDB:O35926	0.559	0.470	5.803E-22	369	0.537	0.447	O35926.pdb.gz	CD5R2_MOUSE Cyclin-dependent kinase 5 activator 2 OS=Mus musculus OX=10090 GN=Cdk5r2 PE=1 SV=2
6	AFDB:Q9Y0G0	0.497	0.323	1.154E-18	474	0.404	0.262	Q9Y0G0.pdb.gz	Q9Y0G0_DROME Cyclin-dependent kinase 5 activator OS=Drosophila melanogaster OX=7227 GN=Cdk5alpha PE=2 SV=1
7	AFDB:Q22695	0.521	0.453	5.514E-15	356	0.322	0.278	Q22695.pdb.gz	CD5R1_CAEEL Cyclin-dependent kinase 5 activator 1 OS=Caenorhabditis elegans OX=6239 GN=cdka-1 PE=2 SV=2
8	AFDB:Q54ZC9	0.329	0.230	5.844E-2	463	0.140	0.093	Q54ZC9.pdb.gz	Q54ZC9_DICDI Cyclin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277667 PE=3 SV=1
9	AFDB:F4IBX5	0.115	0.096	1.155E-1	405	0.147	0.111	F4IBX5.pdb.gz	F4IBX5_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g78915 PE=1 SV=1
10	AFDB:P97287	0.128	0.121	1.337E-1	331	0.137	0.127	P97287.pdb.gz	MCL1_MOUSE Induced myeloid leukemia cell differentiation protein Mcl-1 homolog OS=Mus musculus OX=10090 GN=Mcl1 PE=1 SV=3
11	PDB:3godA	0.103	0.101	3.567E-1	320	0.065	0.062	3godA.pdb.gz	Structural Basis for DNase Activity of a Conserved Protein Implicated in CRISPR-Mediated Genome Defense.
12	PDB:7egb9	0.182	0.192	4.128E-1	287	0.075	0.080	7egb9.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:1g3nC	0.221	0.281	5.528E-1	233	0.049	0.064	1g3nC.pdb.gz
14	PDB:6gzhB	0.180	0.209	7.052E-1	252	0.059	0.071	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
15	PDB:7mq8LT	0.114	0.057	7.052E-1	869	0.101	0.036	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	PDB:1zp2A	0.210	0.271	7.403E-1	227	0.046	0.062	1zp2A.pdb.gz
17	PDB:4pacA	0.117	0.162	8.995E-1	153	0.075	0.150	4pacA.pdb.gz
18	PDB:5oxpA	0.133	0.100	8.995E-1	462	0.062	0.041	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
19	PDB:6o6pA	0.108	0.168	1.093	188	0.078	0.128	6o6pA.pdb.gz	Mycobacterium tuberculosis FasR senses long fatty acyl-CoA through a tunnel and a hydrophobic transmission spine.
20	PDB:7jv7B	0.167	0.166	1.093	310	0.055	0.055	7jv7B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q6W4	0.0	514	304	0.811	0.819	F1Q6W4_DANRE Cyclin-dependent kinase 5 activator OS=Danio rerio OX=7955 GN=cdk5r1 PE=3 SV=1
2	P61809	0.0	626	307	0.984	0.984	CD5R1_MOUSE Cyclin-dependent kinase 5 activator 1 OS=Mus musculus OX=10090 GN=Cdk5r1 PE=1 SV=1
3	P61810	0.0	626	307	0.984	0.984	CD5R1_RAT Cyclin-dependent kinase 5 activator 1 OS=Rattus norvegicus OX=10116 GN=Cdk5r1 PE=1 SV=1
4	Q15078	0.0	636	307	1.000	1.000	CD5R1_HUMAN Cyclin-dependent kinase 5 activator 1 OS=Homo sapiens OX=9606 GN=CDK5R1 PE=1 SV=1
5	Q28199	0.0	630	307	0.993	0.993	CD5R1_BOVIN Cyclin-dependent kinase 5 activator 1 OS=Bos taurus OX=9913 GN=CDK5R1 PE=1 SV=1
6	Q8N619	0.0	634	307	0.997	0.997	Q8N619_HUMAN Cyclin-dependent kinase 5 activator OS=Homo sapiens OX=9606 GN=CDK5R1 PE=1 SV=1
7	Q8TAM4	0.0	634	307	0.997	0.997	Q8TAM4_HUMAN Cyclin-dependent kinase 5 activator OS=Homo sapiens OX=9606 GN=CDK5R1 PE=1 SV=1
8	B3DH98	1.10e-139	398	306	0.668	0.670	B3DH98_DANRE Cyclin-dependent kinase 5 activator OS=Danio rerio OX=7955 GN=LOC568402 PE=2 SV=1
9	Q568S1	4.61e-108	318	308	0.570	0.568	Q568S1_DANRE Cyclin-dependent kinase 5 activator OS=Danio rerio OX=7955 GN=zgc:110126 PE=2 SV=1
10	Q13319	1.52e-87	268	367	0.531	0.444	CD5R2_HUMAN Cyclin-dependent kinase 5 activator 2 OS=Homo sapiens OX=9606 GN=CDK5R2 PE=1 SV=1
11	F1M491	6.57e-85	261	368	0.531	0.443	F1M491_RAT Cyclin-dependent kinase 5 activator OS=Rattus norvegicus OX=10116 GN=Cdk5r2 PE=3 SV=2
12	O35926	1.21e-83	258	369	0.524	0.436	CD5R2_MOUSE Cyclin-dependent kinase 5 activator 2 OS=Mus musculus OX=10090 GN=Cdk5r2 PE=1 SV=2
13	Q9V3H5	2.44e-71	229	472	0.365	0.237	Q9V3H5_DROME Cyclin-dependent kinase 5 activator OS=Drosophila melanogaster OX=7227 GN=Cdk5alpha PE=2 SV=1
14	Q9Y0G0	1.16e-70	228	474	0.326	0.211	Q9Y0G0_DROME Cyclin-dependent kinase 5 activator OS=Drosophila melanogaster OX=7227 GN=Cdk5alpha PE=2 SV=1
15	Q22695	6.27e-50	171	356	0.267	0.230	CD5R1_CAEEL Cyclin-dependent kinase 5 activator 1 OS=Caenorhabditis elegans OX=6239 GN=cdka-1 PE=2 SV=2
16	P34641	3.1	32.0	1418	0.072	0.016	CED11_CAEEL Protein ced-11 OS=Caenorhabditis elegans OX=6239 GN=ced-11 PE=4 SV=1
17	Q3V300	5.8	31.2	660	0.127	0.059	KIF22_MOUSE Kinesin-like protein KIF22 OS=Mus musculus OX=10090 GN=Kif22 PE=2 SV=2
18	Q9Y6D5	5.9	31.2	1785	0.065	0.011	BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3
19	A0QP27	6.5	31.2	1013	0.062	0.019	MMPL3_MYCS2 Trehalose monomycolate exporter MmpL3 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=mmpL3 PE=1 SV=1
20	Q22307	8.5	30.8	1301	0.137	0.032	DHX9_CAEEL ATP-dependent RNA helicase A OS=Caenorhabditis elegans OX=6239 GN=rha-1 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03261 CDK5_activator	2.5e-97	338.0	Cyclin-dependent kinase 5 activator protein
2	PF14920 MTBP_C	4.9e+02	11.8	MDM2-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000002663

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000002991	0.998	Cyclin-dependent kinase 5
2	60711.ENSCSAP00000012220	0.929	Calpain 2, (m/II) large subunit
3	60711.ENSCSAP00000000143	0.845	Microtubule-associated protein tau
4	60711.ENSCSAP00000006672	0.738	nudE neurodevelopment protein 1-like 1
5	60711.ENSCSAP00000003386	0.721	Glycogen synthase kinase 3 beta
6	60711.ENSCSAP00000004320	0.667	nudE neurodevelopment protein 1
7	60711.ENSCSAP00000015347	0.666	Protein phosphatase 1, regulatory (inhibitor) subunit 1B
8	60711.ENSCSAP00000003984	0.663	Calpain 1, (mu/I) large subunit
9	60711.ENSCSAP00000000190	0.658	P21 protein (Cdc42/Rac)-activated kinase 1
10	60711.ENSCSAP00000009282	0.652	Transcriptional regulator. Recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes. Binds double-stranded target DNA, irrespective of the cytosine methylation status. Regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. Plays a role in the regulation of cell survival, proliferation and cell death.
11	60711.ENSCSAP00000007551	0.647	Acts as a tumor suppressor in many tumor types
12	60711.ENSCSAP00000010380	0.646	DnaJ (Hsp40) homolog, subfamily C, member 5 beta
13	60711.ENSCSAP00000008542	0.631	Nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
14	60711.ENSCSAP00000007602	0.626	Neuropilin 1
15	60711.ENSCSAP00000011676	0.622	FYN proto-oncogene, Src family tyrosine kinase
16	60711.ENSCSAP00000008349	0.610	Dihydropyrimidinase-like 3
17	60711.ENSCSAP00000003038	0.597	Plexin A3
18	60711.ENSCSAP00000004399	0.590	Plexin A1
19	60711.ENSCSAP00000010457	0.575	Calpastatin
20	60711.ENSCSAP00000002139	0.567	Serine/threonine-protein kinase receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061575	1.000	cyclin-dependent protein serine/threonine kinase activator activity
GO:0019901	0.997	protein kinase binding
GO:0008092	0.945	cytoskeletal protein binding
GO:0003779	0.884	actin binding
GO:0005102	0.864	signaling receptor binding
GO:0044877	0.860	protein-containing complex binding
GO:0051879	0.825	Hsp90 protein binding
GO:0035255	0.816	ionotropic glutamate receptor binding
GO:0002020	0.785	protease binding
GO:0051015	0.752	actin filament binding
GO:0003824	0.588	catalytic activity
GO:0140096	0.341	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0048518	0.986	positive regulation of biological process
GO:0048522	0.969	positive regulation of cellular process
GO:0032501	0.922	multicellular organismal process
GO:0048856	0.920	anatomical structure development
GO:0007275	0.899	multicellular organism development
GO:0016043	0.886	cellular component organization
GO:0048731	0.850	system development
GO:0007399	0.827	nervous system development
GO:0019222	0.794	regulation of metabolic process
GO:0044087	0.780	regulation of cellular component biogenesis
GO:1902903	0.780	regulation of supramolecular fiber organization
GO:0050896	0.768	response to stimulus
GO:0120036	0.754	plasma membrane bounded cell projection organization
GO:0060255	0.753	regulation of macromolecule metabolic process
GO:0065009	0.748	regulation of molecular function
GO:0030154	0.741	cell differentiation
GO:0033043	0.739	regulation of organelle organization
GO:0030182	0.711	neuron differentiation
GO:0080090	0.709	regulation of primary metabolic process
GO:0051171	0.709	regulation of nitrogen compound metabolic process
GO:0032886	0.709	regulation of microtubule-based process
GO:0031323	0.694	regulation of cellular metabolic process
GO:0048519	0.642	negative regulation of biological process
GO:0070507	0.622	regulation of microtubule cytoskeleton organization
GO:0071704	0.612	organic substance metabolic process
GO:0044238	0.609	primary metabolic process
GO:0023052	0.605	signaling
GO:0043254	0.604	regulation of protein-containing complex assembly
GO:0044237	0.593	cellular metabolic process
GO:0051716	0.592	cellular response to stimulus
GO:0006807	0.567	nitrogen compound metabolic process
GO:0051130	0.563	positive regulation of cellular component organization
GO:0032271	0.550	regulation of protein polymerization
GO:0031110	0.538	regulation of microtubule polymerization or depolymerization
GO:0043170	0.508	macromolecule metabolic process
GO:0032879	0.506	regulation of localization
GO:0007154	0.488	cell communication
GO:0007165	0.474	signal transduction
GO:0051246	0.464	regulation of protein metabolic process
GO:0050790	0.462	regulation of catalytic activity
GO:0044089	0.459	positive regulation of cellular component biogenesis
GO:0048523	0.458	negative regulation of cellular process
GO:0009893	0.456	positive regulation of metabolic process
GO:1901564	0.448	organonitrogen compound metabolic process
GO:0019538	0.422	protein metabolic process
GO:0010468	0.421	regulation of gene expression
GO:0023051	0.410	regulation of signaling
GO:0010646	0.410	regulation of cell communication
GO:0010604	0.408	positive regulation of macromolecule metabolic process
GO:0031399	0.404	regulation of protein modification process
GO:0051174	0.402	regulation of phosphorus metabolic process
GO:0019220	0.380	regulation of phosphate metabolic process
GO:0048513	0.374	animal organ development
GO:0042325	0.373	regulation of phosphorylation
GO:0031334	0.372	positive regulation of protein-containing complex assembly
GO:0009653	0.364	anatomical structure morphogenesis
GO:0031175	0.358	neuron projection development
GO:0009892	0.342	negative regulation of metabolic process
GO:0051173	0.341	positive regulation of nitrogen compound metabolic process
GO:0042221	0.334	response to chemical
GO:0031325	0.334	positive regulation of cellular metabolic process
GO:0048583	0.331	regulation of response to stimulus
GO:0032273	0.325	positive regulation of protein polymerization
GO:1902905	0.322	positive regulation of supramolecular fiber organization
GO:0009889	0.314	regulation of biosynthetic process
GO:0051247	0.311	positive regulation of protein metabolic process
GO:0060341	0.307	regulation of cellular localization
GO:0036211	0.301	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:1902494	0.996	catalytic complex
GO:0071944	0.996	cell periphery
GO:0005654	0.996	nucleoplasm
GO:0005886	0.993	plasma membrane
GO:1902554	0.986	serine/threonine protein kinase complex
GO:0005829	0.983	cytosol
GO:0043228	0.928	non-membrane-bounded organelle
GO:0043232	0.886	intracellular non-membrane-bounded organelle
GO:0120025	0.848	plasma membrane bounded cell projection
GO:0030427	0.816	site of polarized growth
GO:0030426	0.790	growth cone
GO:0000307	0.671	cyclin-dependent protein kinase holoenzyme complex
GO:0016533	0.624	protein kinase 5 complex
GO:0030054	0.505	cell junction
GO:0012505	0.442	endomembrane system
GO:0005856	0.311	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]