StarFunc result for job id Q15084

User Input

>input (440 residues)
MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQR
LTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTG
EAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDV
WMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTI
KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVA
VLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMA
AINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP
VEDDIDLSDVELDDLGKDEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A384NPU5	0.637	0.637	3.903E-89	440	1.000	1.000	A0A384NPU5.pdb.gz	A0A384NPU5_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:Q9V438	0.600	0.609	8.728E-63	433	0.584	0.594	Q9V438.pdb.gz	PDIA6_DROME Protein disulfide-isomerase A6 homolog OS=Drosophila melanogaster OX=7227 GN=CaBP1 PE=1 SV=1
3	AFDB:Q11067	0.523	0.523	3.055E-62	440	0.555	0.555	Q11067.pdb.gz	PDIA6_CAEEL Protein disulfide-isomerase A6 homolog OS=Caenorhabditis elegans OX=6239 GN=pdi-6 PE=3 SV=1
4	AFDB:Q9MAU6	0.485	0.479	5.427E-53	447	0.432	0.425	Q9MAU6.pdb.gz	PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-2 PE=2 SV=2
5	AFDB:O48773	0.505	0.505	1.686E-52	440	0.418	0.418	O48773.pdb.gz	PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-3 PE=2 SV=1
6	AFDB:Q67UF5	0.491	0.490	7.674E-51	441	0.455	0.454	Q67UF5.pdb.gz	PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica OX=39947 GN=PDIL2-3 PE=2 SV=1
7	AFDB:P34329	0.239	0.173	4.147E-27	618	0.273	0.194	P34329.pdb.gz	PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans OX=6239 GN=C14B9.2 PE=3 SV=2
8	AFDB:P13667	0.248	0.173	5.931E-27	645	0.273	0.186	P13667.pdb.gz	PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2
9	AFDB:P38659	0.243	0.173	2.076E-26	643	0.250	0.171	P38659.pdb.gz	PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2
10	AFDB:Q00216	0.260	0.309	1.352E-24	359	0.234	0.287	Q00216.pdb.gz	TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger OX=5061 GN=tigA PE=2 SV=1
11	PDB:3apoA	0.253	0.169	1.876E-20	688	0.177	0.113	3apoA.pdb.gz
12	PDB:3f8uA	0.275	0.262	2.684E-20	469	0.198	0.186	3f8uA.pdb.gz
13	PDB:4ekzA	0.318	0.303	1.344E-19	469	0.193	0.181	4ekzA.pdb.gz
14	PDB:5gu6A	0.244	0.274	5.560E-17	377	0.152	0.178	5gu6A.pdb.gz
15	PDB:7f05C	0.244	0.280	1.034E-15	355	0.125	0.155	7f05C.pdb.gz	Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer
16	PDB:2r2jA	0.232	0.292	2.442E-14	328	0.139	0.186	2r2jA.pdb.gz
17	PDB:5crgA	0.231	0.269	2.752E-14	354	0.136	0.169	5crgA.pdb.gz	Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.
18	PDB:3ed3A	0.266	0.413	6.499E-13	267	0.143	0.236	3ed3A.pdb.gz
19	PDB:7scdA	0.238	0.270	1.299E-8	371	0.109	0.129	7scdA.pdb.gz	Structural and Substrate Specificity Analysis of 3-O-Sulfotransferase Isoform 5 to Synthesize Heparan Sulfate
20	PDB:6yt3B	0.225	0.261	1.650E-8	376	0.107	0.125	6yt3B.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384NPU5	0.0	900	440	1.000	1.000	A0A384NPU5_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q15084	0.0	900	440	1.000	1.000	PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1
3	Q63081	0.0	839	440	0.948	0.948	PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus OX=10116 GN=Pdia6 PE=1 SV=2
4	Q922R8	0.0	843	440	0.955	0.955	PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus OX=10090 GN=Pdia6 PE=1 SV=3
5	Q9V438	8.69e-165	472	433	0.552	0.561	PDIA6_DROME Protein disulfide-isomerase A6 homolog OS=Drosophila melanogaster OX=7227 GN=CaBP1 PE=1 SV=1
6	Q11067	1.88e-160	461	440	0.523	0.523	PDIA6_CAEEL Protein disulfide-isomerase A6 homolog OS=Caenorhabditis elegans OX=6239 GN=pdi-6 PE=3 SV=1
7	Q67UF5	1.27e-128	380	441	0.441	0.440	PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica OX=39947 GN=PDIL2-3 PE=2 SV=1
8	Q9MAU6	4.12e-128	379	447	0.434	0.427	PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-2 PE=2 SV=2
9	O48773	3.15e-120	359	440	0.414	0.414	PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-3 PE=2 SV=1
10	Q00216	1.39e-46	166	359	0.218	0.267	TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger OX=5061 GN=tigA PE=2 SV=1
11	O22263	1.70e-46	166	361	0.211	0.258	PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana OX=3702 GN=PDIL2-1 PE=2 SV=1
12	P08003	6.31e-44	164	638	0.223	0.154	PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus OX=10090 GN=Pdia4 PE=1 SV=3
13	P13667	8.78e-44	164	645	0.218	0.149	PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2
14	P34329	1.42e-43	163	618	0.236	0.168	PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans OX=6239 GN=C14B9.2 PE=3 SV=2
15	P38659	1.74e-43	163	643	0.220	0.151	PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2
16	Q57WS0	3.62e-40	149	377	0.211	0.247	Q57WS0_TRYB2 Protein disulfide isomerase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.560 PE=3 SV=1
17	Q86UY0	4.49e-38	143	360	0.184	0.225	Q86UY0_HUMAN protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=TXNDC5 PE=1 SV=1
18	Q9VJZ1	7.43e-38	145	510	0.195	0.169	Q9VJZ1_DROME FI21342p1 OS=Drosophila melanogaster OX=7227 GN=anon-WO0118547.80 PE=1 SV=1
19	Q91W90	8.80e-38	144	417	0.186	0.197	TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus OX=10090 GN=Txndc5 PE=1 SV=2
20	Q960C0	8.90e-38	145	510	0.195	0.169	Q960C0_DROME SD08104p OS=Drosophila melanogaster OX=7227 GN=CG9302 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00578 AhpC-TSA	8.8	17.7	AhpC/TSA family
2	PF11539 DUF3228	36	15.3	Protein of unknown function (DUF3228)
3	PF07449 HyaE	58	15.2	Hydrogenase-1 expression protein HyaE
4	PF04756 OST3_OST6	0.00075	30.6	OST3 / OST6 family, transporter family
5	PF00085 Thioredoxin	4.2e-61	214.7	Thioredoxin
6	PF13098 Thioredoxin_2	1.5e-07	43.2	Thioredoxin-like domain
7	PF13192 Thioredoxin_3	2.7	19.4	Thioredoxin domain
8	PF13462 Thioredoxin_4	1.7e+02	13.8	Thioredoxin
9	PF13848 Thioredoxin_6	0.00034	32.0	Thioredoxin-like domain
10	PF13899 Thioredoxin_7	0.00022	32.7	Thioredoxin-like
11	PF13905 Thioredoxin_8	0.017	26.7	Thioredoxin-like
12	PF14595 Thioredoxin_9	2e+02	13.2	Thioredoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000020036

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000009129	0.981	Endoplasmin
2	9598.ENSPTRP00000000984	0.963	Heat shock 70kDa protein 5 (Glucose-regulated protein, 78kDa)
3	9598.ENSPTRP00000018010	0.951	Uncharacterized protein
4	9598.ENSPTRP00000010155	0.944	DnaJ (Hsp40) homolog, subfamily C, member 3
5	9598.ENSPTRP00000007480	0.932	Hypoxia up-regulated 1
6	9598.ENSPTRP00000050902	0.922	DnaJ (Hsp40) homolog, subfamily B, member 11
7	9598.ENSPTRP00000033973	0.918	Protein disulfide-isomerase A4
8	9598.ENSPTRP00000051552	0.902	Pan troglodytes protein disulfide isomerase family A, member 3 (PDIA3), mRNA
9	9598.ENSPTRP00000025845	0.871	Uncharacterized protein
10	9598.ENSPTRP00000012236	0.847	Peptidyl-prolyl cis-trans isomerase
11	9598.ENSPTRP00000016636	0.834	Protein disulfide-isomerase
12	9598.ENSPTRP00000059166	0.826	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit
13	9598.ENSPTRP00000054577	0.803	Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol- pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme a [...]
14	9598.ENSPTRP00000022897	0.792	Histocompatibility (minor) 13
15	9598.ENSPTRP00000010762	0.790	Endoplasmic reticulum oxidoreductase alpha
16	9598.ENSPTRP00000042475	0.790	Uncharacterized protein
17	9598.ENSPTRP00000024308	0.759	Stromal cell-derived factor 2-like 1
18	9598.ENSPTRP00000026437	0.747	Uncharacterized protein
19	9598.ENSPTRP00000024464	0.718	X-box binding protein 1
20	9598.ENSPTRP00000008664	0.698	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016853	0.999	isomerase activity
GO:0015035	0.997	protein-disulfide reductase activity
GO:0043167	0.995	ion binding
GO:0003756	0.993	protein disulfide isomerase activity
GO:0005509	0.827	calcium ion binding
GO:0016671	0.498	oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006457	0.993	protein folding
GO:0065007	0.334	biological regulation
GO:0050789	0.314	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	1.000	endoplasmic reticulum
GO:0070013	0.976	intracellular organelle lumen
GO:0005829	0.894	cytosol
GO:0016020	0.864	membrane
GO:0005788	0.535	endoplasmic reticulum lumen
GO:0031090	0.301	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.8.-.-	1.000	Acting on a sulfur group of donors.
EC:5.-.-.-	0.999	Isomerases.
EC:5.3.4.1	0.993	protein disulfide-isomerase.
EC:1.8.4.-	0.498	With a disulfide as acceptor.

[back to server]