StarFunc result for job id Q15109

User Input

>input (404 residues)
MAAGTAVGAWVLVLSLWGAVVGAQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEA
WKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQI
PGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRH
PETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQL
VVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYS
CVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALALGILGGLGTAALLIGV
ILWQRRQRRGEERKAPENQEEEEERAELNQSEEPEAGESSTGGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15109	1.000	1.000	1.343E-73	404	1.000	1.000	Q15109.pdb.gz	RAGE_HUMAN Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1
2	AFDB:Q62151	0.587	0.590	3.340E-55	402	0.782	0.786	Q62151.pdb.gz	RAGE_MOUSE Advanced glycosylation end product-specific receptor OS=Mus musculus OX=10090 GN=Ager PE=1 SV=2
3	PDB:3o3uN	0.517	0.362	5.399E-39	580	0.520	0.362	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
4	AFDB:Q13740	0.462	0.330	1.820E-21	583	0.186	0.129	Q13740.pdb.gz	CD166_HUMAN CD166 antigen OS=Homo sapiens OX=9606 GN=ALCAM PE=1 SV=2
5	AFDB:P50895	0.420	0.283	3.576E-20	628	0.183	0.118	P50895.pdb.gz	BCAM_HUMAN Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2
6	AFDB:P42292	0.462	0.327	3.764E-20	588	0.163	0.112	P42292.pdb.gz	CD166_CHICK CD166 antigen OS=Gallus gallus OX=9031 GN=ALCAM PE=1 SV=1
7	AFDB:A0S0K7	0.455	0.337	1.165E-19	562	0.151	0.109	A0S0K7.pdb.gz
8	AFDB:Q90460	0.439	0.322	1.668E-19	564	0.173	0.124	Q90460.pdb.gz	C166A_DANRE CD166 antigen homolog A OS=Danio rerio OX=7955 GN=alcama PE=1 SV=1
9	AFDB:Q9R069	0.422	0.286	2.788E-19	622	0.163	0.106	Q9R069.pdb.gz	BCAM_MOUSE Basal cell adhesion molecule OS=Mus musculus OX=10090 GN=Bcam PE=1 SV=1
10	AFDB:Q9EPF2	0.454	0.296	7.784E-19	648	0.176	0.110	Q9EPF2.pdb.gz	MUC18_RAT Cell surface glycoprotein MUC18 OS=Rattus norvegicus OX=10116 GN=Mcam PE=1 SV=2
11	AFDB:P43121	0.454	0.297	6.389E-18	646	0.181	0.113	P43121.pdb.gz	MUC18_HUMAN Cell surface glycoprotein MUC18 OS=Homo sapiens OX=9606 GN=MCAM PE=1 SV=2
12	PDB:6dldD	0.326	0.463	1.067E-10	269	0.126	0.190	6dldD.pdb.gz
13	PDB:2rcjC	0.276	0.230	3.686E-9	523	0.141	0.109	2rcjC.pdb.gz
14	PDB:6dlfA	0.314	0.494	1.201E-8	236	0.134	0.229	6dlfA.pdb.gz
15	PDB:5oj2B	0.230	0.150	2.874E-8	692	0.134	0.078	5oj2B.pdb.gz
16	PDB:1igtB	0.211	0.199	3.715E-8	444	0.136	0.124	1igtB.pdb.gz	Refined structure of an intact IgG2a monoclonal antibody.
17	PDB:1aqkL	0.235	0.350	6.880E-8	216	0.097	0.181	1aqkL.pdb.gz
18	PDB:1ngwH	0.208	0.347	6.880E-8	216	0.099	0.185	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
19	PDB:1igaA	0.235	0.209	1.150E-7	475	0.126	0.107	1igaA.pdb.gz
20	PDB:1hzhH	0.229	0.211	2.359E-7	457	0.121	0.107	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15109	0.0	801	404	1.000	1.000	RAGE_HUMAN Advanced glycosylation end product-specific receptor OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=1
2	Q62151	0.0	587	402	0.782	0.786	RAGE_MOUSE Advanced glycosylation end product-specific receptor OS=Mus musculus OX=10090 GN=Ager PE=1 SV=2
3	Q63495	0.0	573	402	0.780	0.784	RAGE_RAT Advanced glycosylation end product-specific receptor OS=Rattus norvegicus OX=10116 GN=Ager PE=1 SV=1
4	Q5SSZ2	5.15e-153	433	233	0.537	0.931	Q5SSZ2_HUMAN Advanced glycosylation end product-specific receptor (Fragment) OS=Homo sapiens OX=9606 GN=AGER PE=1 SV=2
5	Q61490	6.79e-17	84.7	583	0.158	0.110	CD166_MOUSE CD166 antigen OS=Mus musculus OX=10090 GN=Alcam PE=1 SV=3
6	Q13740	7.36e-17	84.7	583	0.161	0.111	CD166_HUMAN CD166 antigen OS=Homo sapiens OX=9606 GN=ALCAM PE=1 SV=2
7	Q90460	1.40e-15	80.9	564	0.198	0.142	C166A_DANRE CD166 antigen homolog A OS=Danio rerio OX=7955 GN=alcama PE=1 SV=1
8	P42292	1.52e-15	80.9	588	0.146	0.100	CD166_CHICK CD166 antigen OS=Gallus gallus OX=9031 GN=ALCAM PE=1 SV=1
9	E7F3V2	2.04e-15	80.9	4212	0.223	0.021	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
10	F1QE54	1.41e-14	77.8	562	0.176	0.126	F1QE54_DANRE Activated leukocyte cell adhesion molecule b OS=Danio rerio OX=7955 GN=fb53h09 PE=1 SV=1
11	Q90989	9.08e-14	75.1	584	0.153	0.106	Q90989_CHICK S-gicerin OS=Gallus gallus OX=9031 PE=2 SV=1
12	Q90880	9.14e-14	75.1	626	0.153	0.099	Q90880_CHICK L-gicerin OS=Gallus gallus OX=9031 PE=2 SV=1
13	A2AJ76	1.95e-11	68.6	5100	0.210	0.017	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
14	F1RE66	2.15e-11	68.2	1134	0.181	0.064	F1RE66_DANRE Roundabout homolog 4 isoform X1 OS=Danio rerio OX=7955 GN=robo4 PE=4 SV=1
15	Q90Z42	2.45e-11	66.6	330	0.181	0.221	Q90Z42_CHICK Roundabout1 protein (Fragment) OS=Gallus gallus OX=9031 GN=ROBO1 PE=2 SV=1
16	Q8NDA2	5.24e-11	67.4	5059	0.213	0.017	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
17	Q5IFI2	5.73e-11	66.6	617	0.149	0.097	Q5IFI2_DANRE Cell surface glycoprotein MUC18 precursor OS=Danio rerio OX=7955 GN=mcam PE=1 SV=1
18	P43121	8.25e-11	66.2	646	0.153	0.096	MUC18_HUMAN Cell surface glycoprotein MUC18 OS=Homo sapiens OX=9606 GN=MCAM PE=1 SV=2
19	D3Z4M6	1.74e-10	65.5	1402	0.215	0.062	D3Z4M6_MOUSE Roundabout guidance receptor 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=1
20	Q9Z2I4	1.76e-10	65.5	1366	0.215	0.064	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06832 BiPBP_C	1.3e+02	14.0	Penicillin-Binding Protein C-terminus Family
2	PF05790 C2-set	1.7e+02	13.8	Immunoglobulin C2-set domain
3	PF08205 C2-set_2	4.6e-26	102.0	CD80-like C2-set immunoglobulin domain
4	PF20087 DUF6479	1e+02	15.0	Family of unknown function (DUF6479)
5	PF07679 I-set	1.9e-13	61.6	Immunoglobulin I-set domain
6	PF00047 ig	5e-13	60.4	Immunoglobulin domain
7	PF13895 Ig_2	5e-19	79.7	Immunoglobulin domain
8	PF13927 Ig_3	4.2e-21	86.6	Immunoglobulin domain
9	PF16680 Ig_4	0.77	21.7	T-cell surface glycoprotein CD3 delta chain
10	PF16706 Izumo-Ig	0.4	22.0	Izumo-like Immunoglobulin domain
11	PF07686 V-set	2e-06	39.3	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000050324

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000024154	0.990	S100 calcium binding protein B
2	9598.ENSPTRP00000002278	0.941	S100 calcium binding protein A6
3	9598.ENSPTRP00000025339	0.923	Uncharacterized protein
4	9598.ENSPTRP00000060981	0.923	Uncharacterized protein
5	9598.ENSPTRP00000027366	0.879	S100 calcium binding protein P
6	9598.ENSPTRP00000002271	0.859	S100 calcium binding protein A12
7	9598.ENSPTRP00000047447	0.836	Uncharacterized protein
8	9598.ENSPTRP00000008150	0.821	Uncharacterized protein
9	9598.ENSPTRP00000005495	0.818	HRas proto-oncogene, GTPase
10	9598.ENSPTRP00000047715	0.816	NADPH oxidase 4
11	9598.ENSPTRP00000001956	0.808	Neuroblastoma RAS viral (V-ras) oncogene homolog
12	9598.ENSPTRP00000035490	0.806	Tyrosine-protein kinase
13	9598.ENSPTRP00000051743	0.790	S100 calcium binding protein A13
14	9598.ENSPTRP00000002273	0.772	S100 calcium binding protein A4
15	9598.ENSPTRP00000028484	0.761	High mobility group box 2
16	9598.ENSPTRP00000036398	0.754	Pan troglodytes toll-like receptor 4 (TLR4), mRNA
17	9598.ENSPTRP00000004339	0.752	Pan troglodytes transcription factor A, mitochondrial (TFAM), nuclear gene encoding mitochondrial protein, mRNA
18	9598.ENSPTRP00000016916	0.732	Thyroid hormone-binding protein. Probably transports thyroxine from the bloodstream to the brain (By similarity).
19	9598.ENSPTRP00000038541	0.724	High mobility group box 3
20	9598.ENSPTRP00000002223	0.723	S100 calcium binding protein A11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.972	identical protein binding
GO:0038023	0.916	signaling receptor activity
GO:0004888	0.498	transmembrane signaling receptor activity
GO:0044548	0.453	S100 protein binding
GO:0044877	0.407	protein-containing complex binding
GO:0038024	0.308	cargo receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051716	0.989	cellular response to stimulus
GO:0048522	0.989	positive regulation of cellular process
GO:0042221	0.987	response to chemical
GO:0048583	0.987	regulation of response to stimulus
GO:0051239	0.986	regulation of multicellular organismal process
GO:0060255	0.986	regulation of macromolecule metabolic process
GO:0051246	0.981	regulation of protein metabolic process
GO:0032501	0.977	multicellular organismal process
GO:0048519	0.975	negative regulation of biological process
GO:0010604	0.975	positive regulation of macromolecule metabolic process
GO:0002269	0.969	leukocyte activation involved in inflammatory response
GO:0010468	0.968	regulation of gene expression
GO:0019220	0.968	regulation of phosphate metabolic process
GO:0061900	0.967	glial cell activation
GO:0031325	0.967	positive regulation of cellular metabolic process
GO:0044093	0.966	positive regulation of molecular function
GO:0051240	0.966	positive regulation of multicellular organismal process
GO:0031399	0.966	regulation of protein modification process
GO:0042327	0.964	positive regulation of phosphorylation
GO:0070887	0.962	cellular response to chemical stimulus
GO:0042127	0.958	regulation of cell population proliferation
GO:0023052	0.956	signaling
GO:0031401	0.956	positive regulation of protein modification process
GO:0001817	0.955	regulation of cytokine production
GO:1902531	0.955	regulation of intracellular signal transduction
GO:0080134	0.953	regulation of response to stress
GO:0043408	0.952	regulation of MAPK cascade
GO:0040017	0.950	positive regulation of locomotion
GO:0001934	0.950	positive regulation of protein phosphorylation
GO:0048584	0.945	positive regulation of response to stimulus
GO:0001819	0.944	positive regulation of cytokine production
GO:0051347	0.940	positive regulation of transferase activity
GO:1904645	0.938	response to amyloid-beta
GO:0048856	0.936	anatomical structure development
GO:0030334	0.936	regulation of cell migration
GO:0051241	0.935	negative regulation of multicellular organismal process
GO:0030335	0.934	positive regulation of cell migration
GO:0065008	0.933	regulation of biological quality
GO:0043410	0.931	positive regulation of MAPK cascade
GO:0007154	0.923	cell communication
GO:0032872	0.920	regulation of stress-activated MAPK cascade
GO:0008284	0.915	positive regulation of cell population proliferation
GO:1901701	0.912	cellular response to oxygen-containing compound
GO:0007275	0.908	multicellular organism development
GO:0071310	0.908	cellular response to organic substance
GO:1900744	0.903	regulation of p38MAPK cascade
GO:0007165	0.894	signal transduction
GO:0045597	0.890	positive regulation of cell differentiation
GO:0048523	0.882	negative regulation of cellular process
GO:1900271	0.877	regulation of long-term synaptic potentiation
GO:0032103	0.873	positive regulation of response to external stimulus
GO:0009892	0.860	negative regulation of metabolic process
GO:0071840	0.850	cellular component organization or biogenesis
GO:0009743	0.844	response to carbohydrate
GO:0016043	0.843	cellular component organization
GO:0010605	0.835	negative regulation of macromolecule metabolic process
GO:0048731	0.826	system development
GO:0071331	0.808	cellular response to hexose stimulus
GO:0030155	0.804	regulation of cell adhesion
GO:0021782	0.803	glial cell development
GO:0009605	0.802	response to external stimulus
GO:0051179	0.798	localization
GO:0031347	0.797	regulation of defense response
GO:0051128	0.786	regulation of cellular component organization
GO:0050776	0.776	regulation of immune response
GO:0002684	0.773	positive regulation of immune system process
GO:0008152	0.771	metabolic process
GO:0006955	0.770	immune response
GO:0009889	0.763	regulation of biosynthetic process
GO:0002274	0.733	myeloid leukocyte activation
GO:0010941	0.731	regulation of cell death
GO:0032879	0.718	regulation of localization
GO:0051049	0.702	regulation of transport
GO:0033554	0.689	cellular response to stress
GO:0010942	0.689	positive regulation of cell death
GO:0007166	0.689	cell surface receptor signaling pathway
GO:0042116	0.686	macrophage activation
GO:2001141	0.667	regulation of RNA biosynthetic process
GO:0007417	0.666	central nervous system development
GO:0071704	0.657	organic substance metabolic process
GO:0006355	0.654	regulation of DNA-templated transcription
GO:0009628	0.645	response to abiotic stimulus
GO:0003008	0.619	system process
GO:0051234	0.608	establishment of localization
GO:2000026	0.607	regulation of multicellular organismal development
GO:0006810	0.599	transport
GO:0001678	0.576	intracellular glucose homeostasis
GO:0071333	0.508	cellular response to glucose stimulus
GO:0044238	0.506	primary metabolic process
GO:0006807	0.470	nitrogen compound metabolic process
GO:0044237	0.460	cellular metabolic process
GO:0009611	0.378	response to wounding
GO:0043170	0.330	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0005576	0.904	extracellular region
GO:0005737	0.845	cytoplasm
GO:0043233	0.835	organelle lumen
GO:0070013	0.833	intracellular organelle lumen
GO:0012505	0.787	endomembrane system
GO:0005634	0.750	nucleus
GO:0030054	0.560	cell junction
GO:0031982	0.554	vesicle
GO:0031981	0.547	nuclear lumen
GO:0043228	0.489	non-membrane-bounded organelle
GO:0043232	0.440	intracellular non-membrane-bounded organelle
GO:0098590	0.398	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]