StarFunc result for job id Q15111

User Input

>input (1095 residues)
MAEGAAGREDPAPPDAAGGEDDPRVGPDAAGDCVTAASGGRMRDRRSGVALPGAAGTPAD
SEAGLLEAARATPRRSSIIKDPSNQKCGGRKKTVSFSSMPSEKKISSANDCISFMQAGCE
LKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGL
ADQICEDCAFSILHGENYESLDLVANSADVANIWVSGLRYLVSRSKQPLDFMEGNQNTPR
FMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTE
EEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITEDICLDIIRRY
ELSEEGRQKGFLAIDGFTQYLLSSECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIED
QFRGPADINGYIRALKMGCRSVELDVSDGSDNEPILCNRNNMTTHVSFRSVIEVINKFAF
VASEYPLILCLGNHCSLPQQKVMAQQMKKVFGNKLYTEAPLPSESYLPSPEKLKRMIIVK
GKKLPSDPDVLEGEVTDEDEEAEMSRRMSVDYNGEQKQIRLCRELSDLVSICKSVQYRDF
ELSMKSQNYWEMCSFSETEASRIANEYPEDFVNYNKKFLSRIYPSAMRIDSSNLNPQDFW
NCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGILPGVSP
LALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQQNSDNPIFDE
TFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVT
LFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDM
RENMQNAIVSIKELCGLPPIASLKQCLLTLSSRLITSDNTPSVSLVMKDSFPYLEPLGAI
PDVQKKMLTAYDLMIQESRFLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKL
NKATESFAWNITVLKGQGDLLKNAKNEAIENMKQIQLACLSCGLSKAPSSSAEAKSKRSL
EAIEEKESSEENGKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8K394	0.901	0.875	0.000	1128	0.652	0.633	Q8K394.pdb.gz	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
2	AFDB:F1Q5G9	0.501	0.710	9.363E-73	761	0.258	0.372	F1Q5G9.pdb.gz	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
3	AFDB:O75038	0.491	0.383	9.657E-71	1416	0.291	0.225	O75038.pdb.gz	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
4	AFDB:Q9BRC7	0.485	0.687	3.510E-70	762	0.260	0.374	Q9BRC7.pdb.gz	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
5	AFDB:F1QJ13	0.490	0.685	5.660E-70	769	0.268	0.381	F1QJ13.pdb.gz	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
6	AFDB:C9JEA7	0.479	0.651	1.276E-69	794	0.262	0.361	C9JEA7.pdb.gz	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
7	AFDB:P10688	0.492	0.698	2.613E-69	756	0.261	0.378	P10688.pdb.gz	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
8	AFDB:Q62711	0.480	0.669	1.206E-68	772	0.253	0.359	Q62711.pdb.gz	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
9	AFDB:Q4KWH8	0.486	0.319	1.854E-68	1693	0.283	0.183	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
10	AFDB:Q8K3R3	0.481	0.643	9.415E-68	807	0.251	0.341	Q8K3R3.pdb.gz	PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus OX=10090 GN=Plcd4 PE=1 SV=2
11	PDB:4gnkB	0.456	0.636	1.383E-51	769	0.221	0.315	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:1cjyA	0.104	0.174	1.154E-7	633	0.032	0.055	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5ixcA	0.102	0.160	1.936E-6	684	0.021	0.034	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5izrC	0.098	0.159	3.780E-6	659	0.021	0.035	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:7lq1A	0.094	0.107	6.707E-6	950	0.047	0.055	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
16	PDB:5itdA	0.098	0.107	1.441E-5	995	0.048	0.053	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
17	PDB:4rj9A	0.097	0.588	1.830E-5	161	0.020	0.137	4rj9A.pdb.gz
18	PDB:5iz5B	0.105	0.153	1.920E-5	746	0.024	0.035	5iz5B.pdb.gz
19	PDB:3nsjA	0.093	0.183	2.215E-5	530	0.026	0.055	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
20	PDB:5iz5A	0.097	0.139	2.215E-5	757	0.024	0.034	5iz5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15111	0.0	2278	1095	1.000	1.000	PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3
2	Q3USB7	0.0	2118	1096	0.943	0.943	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3
3	Q62688	0.0	2115	1096	0.941	0.940	PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus OX=10116 GN=Plcl1 PE=1 SV=1
4	Q8K394	0.0	1459	1128	0.645	0.626	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
5	Q9UPR0	0.0	1452	1127	0.641	0.623	PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2
6	F1Q5G9	2.02e-159	493	761	0.260	0.375	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
7	Q9BRC7	1.75e-154	480	762	0.264	0.379	PLCD4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
8	C9JEA7	6.65e-154	479	794	0.261	0.360	C9JEA7_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCD4 PE=1 SV=1
9	Q8R3B1	2.45e-151	471	756	0.261	0.378	PLCD1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Mus musculus OX=10090 GN=Plcd1 PE=1 SV=2
10	P10688	2.97e-151	471	756	0.261	0.378	PLCD1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Rattus norvegicus OX=10116 GN=Plcd1 PE=1 SV=1
11	F1QJ13	4.87e-151	471	769	0.265	0.377	F1QJ13_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd3b PE=4 SV=1
12	Q62711	1.04e-148	465	772	0.256	0.363	PLCD4_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Rattus norvegicus OX=10116 GN=Plcd4 PE=1 SV=1
13	P51178	9.52e-144	452	756	0.255	0.369	PLCD1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens OX=9606 GN=PLCD1 PE=1 SV=2
14	Q86YW0	6.60e-142	442	608	0.218	0.393	PLCZ1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Homo sapiens OX=9606 GN=PLCZ1 PE=1 SV=1
15	Q8N3E9	7.77e-136	432	789	0.245	0.340	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
16	Q8K2J0	6.39e-134	427	785	0.244	0.340	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
17	A0A8I6AGE0	6.47e-131	417	744	0.241	0.355	A0A8I6AGE0_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=4 SV=1
18	Q8K4D7	1.34e-130	413	647	0.215	0.363	PLCZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Mus musculus OX=10090 GN=Plcz1 PE=1 SV=1
19	Q5FX52	3.80e-127	404	645	0.208	0.353	PLCZ1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase zeta-1 OS=Rattus norvegicus OX=10116 GN=Plcz1 PE=2 SV=1
20	H2LIC9	9.00e-112	364	659	0.198	0.329	H2LIC9_ORYLA Phosphoinositide phospholipase C OS=Oryzias latipes OX=8090 GN=PLCZ1 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	4.8e-14	63.9	C2 domain
2	PF13499 EF-hand_7	85	15.0	EF-hand domain pair
3	PF09279 EF-hand_like	2e-11	55.5	Phosphoinositide-specific phospholipase C, efhand-like
4	PF00169 PH	71	15.3	PH domain
5	PF16457 PH_12	3.3e-15	68.2	Pleckstrin homology domain
6	PF17787 PH_14	0.0077	27.5	PH domain
7	PF00388 PI-PLC-X	8.5e-49	176.3	Phosphatidylinositol-specific phospholipase C, X domain
8	PF00387 PI-PLC-Y	1e-35	133.9	Phosphatidylinositol-specific phospholipase C, Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000402861

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261592	0.739	Nucleolar protein 4
2	9606.ENSP00000378176	0.640	Phosphatidylcholine:ceramide cholinephosphotransferase 2
3	9606.ENSP00000482571	0.638	Glycerol-3-phosphate acyltransferase 3
4	9606.ENSP00000367848	0.631	Gamma-aminobutyric acid receptor subunit delta
5	9606.ENSP00000274547	0.629	Gamma-aminobutyric acid receptor subunit beta-2
6	9606.ENSP00000295452	0.629	Gamma-aminobutyric acid receptor subunit gamma-1
7	9606.ENSP00000393097	0.628	Gamma-aminobutyric acid receptor subunit alpha-1
8	9606.ENSP00000274545	0.627	Gamma-aminobutyric acid receptor subunit alpha-6
9	9606.ENSP00000295454	0.625	Gamma-aminobutyric acid receptor subunit beta-1
10	9606.ENSP00000264318	0.620	Gamma-aminobutyric acid receptor subunit alpha-4
11	9606.ENSP00000421828	0.615	Gamma-aminobutyric acid receptor subunit alpha-2
12	9606.ENSP00000335592	0.614	Gamma-aminobutyric acid receptor subunit alpha-5
13	9606.ENSP00000308725	0.610	Gamma-aminobutyric acid receptor subunit beta-3
14	9606.ENSP00000359337	0.608	Gamma-aminobutyric acid receptor subunit alpha-3
15	9606.ENSP00000430100	0.608	Gamma-aminobutyric acid receptor subunit pi
16	9606.ENSP00000469332	0.608	Gamma-aminobutyric acid receptor subunit theta
17	9606.ENSP00000479113	0.608	Gamma-aminobutyric acid receptor subunit gamma-3
18	9606.ENSP00000359353	0.600	Gamma-aminobutyric acid receptor subunit epsilon
19	9606.ENSP00000361120	0.576	Ral guanine nucleotide dissociation stimulator
20	9606.ENSP00000366249	0.571	Ubiquitin D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050811	1.000	GABA receptor binding
GO:0004629	0.997	phospholipase C activity
GO:0004435	0.830	phosphatidylinositol phospholipase C activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.997	cellular process
GO:0023052	0.990	signaling
GO:0007154	0.990	cell communication
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.927	cellular response to stimulus
GO:0007165	0.709	signal transduction
GO:0007214	0.688	gamma-aminobutyric acid signaling pathway
GO:0043393	0.544	regulation of protein binding
GO:0019222	0.447	regulation of metabolic process
GO:0048519	0.421	negative regulation of biological process
GO:0023051	0.416	regulation of signaling
GO:0010646	0.416	regulation of cell communication
GO:0035556	0.317	intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.966	membrane
GO:0005829	0.965	cytosol
GO:0005886	0.959	plasma membrane
GO:0043226	0.727	organelle
GO:0043227	0.454	membrane-bounded organelle
GO:0043229	0.444	intracellular organelle
GO:0043231	0.407	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	0.997	Phosphoric diester hydrolases.
RHEA:33179	0.830	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.830	phosphoinositide phospholipase C.

[back to server]