StarFunc result for job id Q15118

User Input

>input (436 residues)
MRLARLLRGAALAGPGPGLRAAGFSRSFSSDSGSSPASERGVPGQVDFYARFSPSPLSMK
QFLDFGSVNACEKTSFMFLRQELPVRLANIMKEISLLPDNLLRTPSVQLVQSWYIQSLQE
LLDFKDKSAEDAKAIYDFTDTVIRIRNRHNDVIPTMAQGVIEYKESFGVDPVTSQNVQYF
LDRFYMSRISIRMLLNQHSLLFGGKGKGSPSHRKHIGSINPNCNVLEVIKDGYENARRLC
DLYYINSPELELEELNAKSPGQPIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPP
IQVHVTLGNEDLTVKMSDRGGGVPLRKIDRLFNYMYSTAPRPRVETSRAVPLAGFGYGLP
ISRLYAQYFQGDLKLYSLEGYGTDAVIYIKALSTDSIERLPVYNKAAWKHYNTNHEADDW
CVPSREPKDMTTFRSA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15118	1.000	1.000	1.627E-70	436	1.000	1.000	Q15118.pdb.gz	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
2	AFDB:F1NLP2	0.900	0.962	1.633E-58	408	0.821	0.877	F1NLP2.pdb.gz	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
3	PDB:2q8gA	0.824	0.973	1.979E-53	368	0.844	1.000	2q8gA.pdb.gz	Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
4	AFDB:Q15119	0.889	0.952	2.021E-52	407	0.631	0.676	Q15119.pdb.gz	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
5	AFDB:O54937	0.883	0.934	3.907E-52	412	0.608	0.643	O54937.pdb.gz	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
6	AFDB:B5DFI9	0.893	0.938	5.968E-52	415	0.622	0.653	B5DFI9.pdb.gz
7	PDB:1y8pA	0.854	0.976	1.105E-46	381	0.608	0.696	1y8pA.pdb.gz	Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
8	PDB:3crlB	0.856	0.973	1.688E-46	383	0.612	0.697	3crlB.pdb.gz	Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
9	PDB:3d2rB	0.802	0.962	2.154E-44	362	0.573	0.691	3d2rB.pdb.gz	Pyruvate Dehydrogenase Kinase-4 Structures Reveal a Metastable Open Conformation Fostering Robust Core-free Basal Activity.
10	PDB:5j71A	0.758	0.975	2.502E-42	338	0.555	0.716	5j71A.pdb.gz	Development of Dihydroxyphenyl Sulfonylisoindoline Derivatives as Liver-Targeting Pyruvate Dehydrogenase Kinase Inhibitors.
11	PDB:7ebgA	0.752	0.970	1.129E-41	337	0.532	0.688	7ebgA.pdb.gz	Fragment-based lead discovery to identify novel inhibitors that target the ATP binding site of pyruvate dehydrogenase kinases.
12	AFDB:Q02332	0.856	0.930	2.943E-41	401	0.431	0.469	Q02332.pdb.gz	PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhk-2 PE=3 SV=1
13	PDB:2pnrB	0.760	0.967	1.133E-40	341	0.546	0.698	2pnrB.pdb.gz	Crystal Structure of an Asymmetric complex of Pyruvate Dehydrogenase Kinase 3 with Lipoyl domain 2 and its Biological Implications
14	AFDB:O82424	0.748	0.890	7.507E-31	364	0.319	0.382	O82424.pdb.gz	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
15	AFDB:Q9SBJ1	0.744	0.881	1.094E-30	366	0.321	0.383	Q9SBJ1.pdb.gz	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
16	AFDB:O82423	0.752	0.898	3.900E-30	363	0.312	0.375	O82423.pdb.gz	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
17	AFDB:Q9P6P9	0.720	0.738	1.402E-27	425	0.317	0.325	Q9P6P9.pdb.gz	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1
18	PDB:1gkzA	0.641	0.875	8.002E-23	316	0.241	0.332	1gkzA.pdb.gz	Structure of Rat Bckd Kinase: Nucleotide-Induced Domain Communication in a Mitochondrial Protein Kinase.
19	PDB:7rzwB	0.263	0.147	1.313E-5	864	0.080	0.041	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
20	PDB:6s1kA	0.279	0.312	2.102E-5	383	0.080	0.091	6s1kA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1NLP2	0.0	746	408	0.810	0.865	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
2	O54937	0.0	582	412	0.606	0.641	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
3	O70571	0.0	582	412	0.596	0.631	PDK4_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Mus musculus OX=10090 GN=Pdk4 PE=1 SV=1
4	Q15118	0.0	907	436	1.000	1.000	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
5	Q15119	0.0	604	407	0.635	0.681	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
6	Q15120	0.0	588	406	0.622	0.667	PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3 PE=1 SV=1
7	Q16654	0.0	578	411	0.603	0.640	PDK4_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Homo sapiens OX=9606 GN=PDK4 PE=1 SV=1
8	Q63065	0.0	832	434	0.929	0.933	PDK1_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk1 PE=1 SV=1
9	Q64536	0.0	599	407	0.628	0.673	PDK2_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk2 PE=1 SV=1
10	Q8BFP9	0.0	807	434	0.915	0.919	PDK1_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus OX=10090 GN=Pdk1 PE=1 SV=2
11	Q922H2	0.0	592	415	0.624	0.655	PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus OX=10090 GN=Pdk3 PE=1 SV=1
12	Q9JK42	0.0	598	407	0.628	0.673	PDK2_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Mus musculus OX=10090 GN=Pdk2 PE=1 SV=2
13	Q02332	1.18e-131	387	401	0.433	0.471	PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhk-2 PE=3 SV=1
14	D6RDN9	8.76e-129	374	259	0.388	0.653	D6RDN9_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
15	Q9SBJ1	3.37e-70	228	366	0.326	0.388	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
16	O82424	6.31e-70	227	364	0.335	0.401	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
17	O82423	2.26e-69	226	363	0.321	0.386	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
18	D6RJH7	2.06e-67	213	141	0.218	0.674	D6RJH7_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
19	D6RHG2	2.54e-59	192	129	0.197	0.667	D6RHG2_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
20	Q9P6P9	2.74e-56	193	425	0.241	0.247	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10436 BCDHK_Adom3	7e-46	167.5	Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
2	PF02518 HATPase_c	1.4e-10	53.0	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF13589 HATPase_c_3	11	17.5	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000021603

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000037227	0.990	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2), and thereby links the glycolytic pathway to the tricarboxylic cycle
2	9598.ENSPTRP00000026010	0.985	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
3	9598.ENSPTRP00000027992	0.948	Pyruvate dehydrogenase E1 component subunit alpha
4	9598.ENSPTRP00000048167	0.947	Pyruvate dehydrogenase complex, component X
5	9598.ENSPTRP00000007349	0.864	Acetyltransferase component of pyruvate dehydrogenase complex
6	9598.ENSPTRP00000015943	0.831	Uncharacterized protein
7	9598.ENSPTRP00000033534	0.791	Dihydrolipoyl dehydrogenase
8	9598.ENSPTRP00000037297	0.759	Pyruvate dehydrogenase kinase, isozyme 3
9	9598.ENSPTRP00000016085	0.757	Ribosomal protein S6 kinase, 70kDa, polypeptide 1
10	9598.ENSPTRP00000011569	0.711	Uncharacterized protein
11	9598.ENSPTRP00000005957	0.690	Pan troglodytes lactate dehydrogenase A (LDHA), mRNA
12	9598.ENSPTRP00000006810	0.649	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
13	9598.ENSPTRP00000005986	0.636	Protein arginine methyltransferase 3
14	9598.ENSPTRP00000050982	0.634	Uncharacterized protein
15	9598.ENSPTRP00000018854	0.601	V-akt murine thymoma viral oncogene homolog 2
16	9598.ENSPTRP00000020771	0.601	Hexokinase 2
17	9598.ENSPTRP00000010887	0.593	Uncharacterized protein
18	9598.ENSPTRP00000034767	0.579	Serum/glucocorticoid regulated kinase family, member 3
19	9598.ENSPTRP00000023199	0.567	Uncharacterized protein
20	9598.ENSPTRP00000049596	0.567	Serum/glucocorticoid regulated kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004740	1.000	pyruvate dehydrogenase (acetyl-transferring) kinase activity
GO:1901363	0.965	heterocyclic compound binding
GO:0097159	0.965	organic cyclic compound binding
GO:0005524	0.959	ATP binding
GO:0042802	0.638	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0009987	0.987	cellular process
GO:0050789	0.982	regulation of biological process
GO:0071704	0.973	organic substance metabolic process
GO:0050794	0.966	regulation of cellular process
GO:0044238	0.954	primary metabolic process
GO:0050896	0.858	response to stimulus
GO:0051716	0.829	cellular response to stimulus
GO:0019222	0.655	regulation of metabolic process
GO:0080090	0.645	regulation of primary metabolic process
GO:0031323	0.645	regulation of cellular metabolic process
GO:0044237	0.634	cellular metabolic process
GO:0051171	0.628	regulation of nitrogen compound metabolic process
GO:0042221	0.591	response to chemical
GO:0051174	0.563	regulation of phosphorus metabolic process
GO:0031326	0.550	regulation of cellular biosynthetic process
GO:0019219	0.534	regulation of nucleobase-containing compound metabolic process
GO:0023052	0.515	signaling
GO:0007154	0.515	cell communication
GO:0007165	0.514	signal transduction
GO:0070887	0.503	cellular response to chemical stimulus
GO:0006807	0.442	nitrogen compound metabolic process
GO:0019220	0.432	regulation of phosphate metabolic process
GO:1901564	0.353	organonitrogen compound metabolic process
GO:0044281	0.323	small molecule metabolic process
GO:0062012	0.312	regulation of small molecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0005759	0.992	mitochondrial matrix
GO:0032991	0.916	protein-containing complex
GO:0005634	0.714	nucleus
GO:1902494	0.553	catalytic complex
GO:1990204	0.417	oxidoreductase complex
GO:0031981	0.391	nuclear lumen
GO:0005829	0.337	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23052	1.000	ATP + L-seryl-[pyruvate dehydrogenase E1 alpha subunit] = ADP + H(+) + O-phospho-L-seryl-[pyruvate dehydrogenase E1 alpha subunit]
EC:2.7.11.2	1.000	[pyruvate dehydrogenase (acetyl-transferring)] kinase.

[back to server]