StarFunc result for job id Q15119

User Input

>input (407 residues)
MRWVWALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNACEKTSFTFLRQELPVR
LANIMKEINLLPDRVLSTPSVQLVQSWYVQSLLDIMEFLDKDPEDHRTLSQFTDALVTIR
NRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTLIFDGST
NPAHPKHIGSIDPNCNVSEVVKDAYDMAKLLCDKYYMASPDLEIQEINAANSKQPIHMVY
VPSHLYHMLFELFKNAMRATVESHESSLILPPIKVMVALGEEDLSIKMSDRGGGVPLRKI
ERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQGDLQLFSMEGFGTDAVIYL
KALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKNTSTYRVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15119	1.000	1.000	1.730E-64	407	1.000	1.000	Q15119.pdb.gz	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
2	PDB:3crlB	0.927	0.985	2.088E-54	383	0.919	0.977	3crlB.pdb.gz	Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
3	AFDB:F1NLP2	0.954	0.951	9.295E-52	408	0.693	0.691	F1NLP2.pdb.gz	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
4	AFDB:Q15118	0.952	0.889	1.852E-51	436	0.676	0.631	Q15118.pdb.gz	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
5	AFDB:O54937	0.940	0.928	2.660E-50	412	0.641	0.633	O54937.pdb.gz	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
6	AFDB:B5DFI9	0.948	0.930	3.504E-50	415	0.673	0.660	B5DFI9.pdb.gz
7	PDB:5j71A	0.814	0.978	2.205E-47	338	0.821	0.988	5j71A.pdb.gz	Development of Dihydroxyphenyl Sulfonylisoindoline Derivatives as Liver-Targeting Pyruvate Dehydrogenase Kinase Inhibitors.
8	PDB:1y8pA	0.917	0.978	6.605E-46	381	0.649	0.693	1y8pA.pdb.gz	Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
9	PDB:2q8gA	0.873	0.963	1.573E-44	368	0.646	0.715	2q8gA.pdb.gz	Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
10	PDB:3d2rB	0.862	0.967	1.564E-43	362	0.607	0.682	3d2rB.pdb.gz	Pyruvate Dehydrogenase Kinase-4 Structures Reveal a Metastable Open Conformation Fostering Robust Core-free Basal Activity.
11	AFDB:Q02332	0.923	0.936	1.011E-41	401	0.477	0.484	Q02332.pdb.gz	PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhk-2 PE=3 SV=1
12	PDB:7ebgA	0.811	0.977	2.223E-40	337	0.565	0.682	7ebgA.pdb.gz	Fragment-based lead discovery to identify novel inhibitors that target the ATP binding site of pyruvate dehydrogenase kinases.
13	PDB:2pnrB	0.817	0.973	3.501E-39	341	0.592	0.707	2pnrB.pdb.gz	Crystal Structure of an Asymmetric complex of Pyruvate Dehydrogenase Kinase 3 with Lipoyl domain 2 and its Biological Implications
14	AFDB:O82424	0.803	0.895	3.130E-29	364	0.351	0.393	O82424.pdb.gz	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
15	AFDB:Q9SBJ1	0.800	0.887	7.846E-29	366	0.339	0.377	Q9SBJ1.pdb.gz	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
16	AFDB:O82423	0.807	0.901	9.873E-29	363	0.339	0.380	O82423.pdb.gz	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
17	AFDB:Q9P6P9	0.772	0.741	6.727E-26	425	0.351	0.336	Q9P6P9.pdb.gz	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1
18	PDB:1gkzA	0.684	0.873	8.780E-22	316	0.253	0.326	1gkzA.pdb.gz	Structure of Rat Bckd Kinase: Nucleotide-Induced Domain Communication in a Mitochondrial Protein Kinase.
19	PDB:6s1kA	0.278	0.293	2.214E-5	383	0.076	0.081	6s1kA.pdb.gz
20	PDB:7rzwB	0.282	0.148	2.661E-5	864	0.091	0.043	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6RDN9	0.0	540	259	0.636	1.000	D6RDN9_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
2	F1NLP2	0.0	614	408	0.693	0.691	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
3	O54937	0.0	572	412	0.651	0.643	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
4	O70571	0.0	575	412	0.649	0.641	PDK4_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Mus musculus OX=10090 GN=Pdk4 PE=1 SV=1
5	Q15118	0.0	602	436	0.676	0.631	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
6	Q15119	0.0	851	407	1.000	1.000	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
7	Q15120	0.0	575	406	0.668	0.670	PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3 PE=1 SV=1
8	Q16654	0.0	570	411	0.649	0.642	PDK4_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Homo sapiens OX=9606 GN=PDK4 PE=1 SV=1
9	Q63065	0.0	611	434	0.683	0.641	PDK1_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk1 PE=1 SV=1
10	Q64536	0.0	833	407	0.975	0.975	PDK2_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk2 PE=1 SV=1
11	Q8BFP9	0.0	604	434	0.676	0.634	PDK1_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus OX=10090 GN=Pdk1 PE=1 SV=2
12	Q922H2	0.0	587	415	0.678	0.665	PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus OX=10090 GN=Pdk3 PE=1 SV=1
13	Q9JK42	0.0	833	407	0.975	0.975	PDK2_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Mus musculus OX=10090 GN=Pdk2 PE=1 SV=2
14	Q02332	1.32e-134	393	401	0.489	0.496	PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhk-2 PE=3 SV=1
15	D6RJH7	7.39e-100	295	141	0.346	1.000	D6RJH7_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
16	D6RHG2	6.11e-90	269	129	0.317	1.000	D6RHG2_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
17	O82424	7.15e-75	239	364	0.354	0.396	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
18	O82423	1.40e-74	238	363	0.344	0.386	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
19	Q9SBJ1	2.23e-73	235	366	0.356	0.396	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
20	Q9P6P9	3.15e-59	200	425	0.280	0.268	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10436 BCDHK_Adom3	2.1e-48	175.7	Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
2	PF02518 HATPase_c	4e-09	48.4	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF13589 HATPase_c_3	71	14.8	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000015203

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000002482	0.926	Acetyltransferase component of pyruvate dehydrogenase complex
2	9593.ENSGGOP00000012827	0.899	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2.
3	9593.ENSGGOP00000001190	0.896	Pyruvate dehydrogenase complex, component X
4	9593.ENSGGOP00000018423	0.867	Pyruvate dehydrogenase E1 component subunit alpha
5	9593.ENSGGOP00000004049	0.842	Pyruvate dehydrogenase kinase, isozyme 1
6	9593.ENSGGOP00000013411	0.767	Pyruvate dehydrogenase E1 component subunit alpha
7	9593.ENSGGOP00000017521	0.764	V-akt murine thymoma viral oncogene homolog 1
8	9593.ENSGGOP00000019074	0.758	Ribosomal protein S6 kinase B1
9	9593.ENSGGOP00000022184	0.758	Uncharacterized protein
10	9593.ENSGGOP00000002531	0.753	Dihydrolipoamide dehydrogenase
11	9593.ENSGGOP00000007562	0.707	V-akt murine thymoma viral oncogene homolog 3
12	9593.ENSGGOP00000010693	0.694	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
13	9593.ENSGGOP00000015543	0.694	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. PKC subfamily
14	9593.ENSGGOP00000000339	0.648	Listerin E3 ubiquitin protein ligase 1
15	9593.ENSGGOP00000017947	0.640	Substrate-binding subunit (component A) of the Rab geranylgeranyltransferase (GGTase) complex. Binds unprenylated Rab proteins and presents the substrate peptide to the catalytic component B. The component A is thought to be regenerated by transferring its prenylated Rab back to the donor membrane.
16	9593.ENSGGOP00000001383	0.615	V-akt murine thymoma viral oncogene homolog 2
17	9593.ENSGGOP00000027197	0.614	Ribosomal protein S6 kinase, 70kDa, polypeptide 2
18	9593.ENSGGOP00000013283	0.595	Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
19	9593.ENSGGOP00000028326	0.584	Branched chain keto acid dehydrogenase E1, beta polypeptide
20	9593.ENSGGOP00000025109	0.580	Belongs to the protein kinase superfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004740	1.000	pyruvate dehydrogenase (acetyl-transferring) kinase activity
GO:0005524	1.000	ATP binding
GO:0042802	0.987	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.957	metabolic process
GO:0071704	0.929	organic substance metabolic process
GO:0044238	0.916	primary metabolic process
GO:0065007	0.873	biological regulation
GO:0050789	0.856	regulation of biological process
GO:0044237	0.830	cellular metabolic process
GO:0050794	0.692	regulation of cellular process
GO:0006807	0.620	nitrogen compound metabolic process
GO:0050896	0.602	response to stimulus
GO:0019222	0.581	regulation of metabolic process
GO:0051716	0.547	cellular response to stimulus
GO:1901564	0.499	organonitrogen compound metabolic process
GO:0031323	0.493	regulation of cellular metabolic process
GO:0080090	0.491	regulation of primary metabolic process
GO:0023052	0.486	signaling
GO:0007154	0.486	cell communication
GO:0051171	0.486	regulation of nitrogen compound metabolic process
GO:0007165	0.470	signal transduction
GO:0031326	0.457	regulation of cellular biosynthetic process
GO:0019220	0.408	regulation of phosphate metabolic process
GO:0070887	0.381	cellular response to chemical stimulus
GO:0006796	0.373	phosphate-containing compound metabolic process
GO:0043170	0.368	macromolecule metabolic process
GO:0019219	0.354	regulation of nucleobase-containing compound metabolic process
GO:0019538	0.336	protein metabolic process
GO:0036211	0.313	protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.997	intracellular organelle lumen
GO:0032991	0.985	protein-containing complex
GO:0005829	0.918	cytosol
GO:0005759	0.777	mitochondrial matrix
GO:1902494	0.727	catalytic complex
GO:1990204	0.458	oxidoreductase complex
GO:0031981	0.387	nuclear lumen
GO:0016020	0.350	membrane
GO:0005654	0.325	nucleoplasm
GO:0045254	0.318	pyruvate dehydrogenase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23052	1.000	ATP + L-seryl-[pyruvate dehydrogenase E1 alpha subunit] = ADP + H(+) + O-phospho-L-seryl-[pyruvate dehydrogenase E1 alpha subunit]
EC:2.7.11.2	1.000	[pyruvate dehydrogenase (acetyl-transferring)] kinase.

[back to server]