StarFunc result for job id Q15120

User Input

>input (406 residues)
MRLFRWLLKQPVPKQIERYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLNRPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHN
DVVPTMAQGVIEYKEKFGFDPFISTNIQYFLDRFYTNRISFRMLINQHTLLFGGDTNPVH
PKHIGSIDPTCNVADVVKDAYETAKMLCEQYYLVAPELEVEEFNAKAPDKPIQVVYVPSH
LFHMLFELFKNSMRATVELYEDRKEGYPAVKTLVTLGKEDLSIKISDLGGGVPLRKIDRL
FNYMYSTAPRPSLEPTRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B5DFI9	0.961	0.941	8.401E-65	415	0.963	0.942	B5DFI9.pdb.gz
2	PDB:1y8pA	0.932	0.993	1.204E-57	381	0.936	0.997	1y8pA.pdb.gz	Crystal structure of pyruvate dehydrogenase kinase 3 bound to lipoyl domain 2 of human pyruvate dehydrogenase complex.
3	AFDB:F1NLP2	0.958	0.953	1.435E-54	408	0.687	0.684	F1NLP2.pdb.gz	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
4	AFDB:Q15118	0.959	0.894	6.152E-53	436	0.667	0.622	Q15118.pdb.gz	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
5	AFDB:Q15119	0.954	0.952	1.267E-52	407	0.670	0.668	Q15119.pdb.gz	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
6	AFDB:O54937	0.943	0.929	1.646E-50	412	0.621	0.612	O54937.pdb.gz	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
7	PDB:2pnrB	0.822	0.976	7.769E-49	341	0.835	0.994	2pnrB.pdb.gz	Crystal Structure of an Asymmetric complex of Pyruvate Dehydrogenase Kinase 3 with Lipoyl domain 2 and its Biological Implications
8	PDB:3crlB	0.916	0.970	3.998E-48	383	0.648	0.687	3crlB.pdb.gz	Structural and functional insights into the molecular mechanisms responsible for the regulation of pyruvate dehydrogenase kinase 2.
9	PDB:2q8gA	0.872	0.960	2.912E-46	368	0.643	0.709	2q8gA.pdb.gz	Distinct Structural Mechanisms for Inhibition of Pyruvate Dehydrogenase Kinase Isoforms by AZD7545, Dichloroacetate, and Radicicol.
10	PDB:3d2rB	0.859	0.962	7.002E-45	362	0.579	0.649	3d2rB.pdb.gz	Pyruvate Dehydrogenase Kinase-4 Structures Reveal a Metastable Open Conformation Fostering Robust Core-free Basal Activity.
11	AFDB:Q02332	0.915	0.926	8.667E-43	401	0.495	0.501	Q02332.pdb.gz	PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhk-2 PE=3 SV=1
12	PDB:5j71A	0.799	0.958	3.183E-42	338	0.567	0.680	5j71A.pdb.gz	Development of Dihydroxyphenyl Sulfonylisoindoline Derivatives as Liver-Targeting Pyruvate Dehydrogenase Kinase Inhibitors.
13	PDB:7ebgA	0.803	0.965	1.803E-41	337	0.537	0.647	7ebgA.pdb.gz	Fragment-based lead discovery to identify novel inhibitors that target the ATP binding site of pyruvate dehydrogenase kinases.
14	AFDB:O82424	0.810	0.900	3.081E-31	364	0.365	0.407	O82424.pdb.gz	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
15	AFDB:O82423	0.814	0.906	4.114E-31	363	0.347	0.388	O82423.pdb.gz	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
16	AFDB:Q9SBJ1	0.807	0.892	1.585E-30	366	0.340	0.377	Q9SBJ1.pdb.gz	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
17	AFDB:Q9P6P9	0.793	0.759	7.935E-28	425	0.337	0.322	Q9P6P9.pdb.gz	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1
18	PDB:1gkzA	0.682	0.868	3.861E-23	316	0.249	0.320	1gkzA.pdb.gz	Structure of Rat Bckd Kinase: Nucleotide-Induced Domain Communication in a Mitochondrial Protein Kinase.
19	PDB:6s1kA	0.289	0.303	8.184E-6	383	0.081	0.086	6s1kA.pdb.gz
20	PDB:7rzwB	0.270	0.142	1.531E-5	864	0.079	0.037	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1NLP2	0.0	606	408	0.687	0.684	F1NLP2_CHICK Protein-serine/threonine kinase OS=Gallus gallus OX=9031 GN=PDK1 PE=1 SV=3
2	O54937	0.0	547	412	0.628	0.619	PDK4_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk4 PE=1 SV=1
3	O70571	0.0	545	412	0.626	0.617	PDK4_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Mus musculus OX=10090 GN=Pdk4 PE=1 SV=1
4	Q15118	0.0	587	436	0.667	0.622	PDK1_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Homo sapiens OX=9606 GN=PDK1 PE=1 SV=1
5	Q15119	0.0	575	407	0.670	0.668	PDK2_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=2
6	Q15120	0.0	842	406	1.000	1.000	PDK3_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Homo sapiens OX=9606 GN=PDK3 PE=1 SV=1
7	Q16654	0.0	542	411	0.616	0.608	PDK4_HUMAN [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 4, mitochondrial OS=Homo sapiens OX=9606 GN=PDK4 PE=1 SV=1
8	Q63065	0.0	593	434	0.667	0.624	PDK1_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk1 PE=1 SV=1
9	Q64536	0.0	582	407	0.675	0.673	PDK2_RAT [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pdk2 PE=1 SV=1
10	Q8BFP9	0.0	587	434	0.665	0.622	PDK1_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial OS=Mus musculus OX=10090 GN=Pdk1 PE=1 SV=2
11	Q922H2	0.0	820	415	0.973	0.952	PDK3_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 3, mitochondrial OS=Mus musculus OX=10090 GN=Pdk3 PE=1 SV=1
12	Q9JK42	0.0	580	407	0.672	0.671	PDK2_MOUSE [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 2, mitochondrial OS=Mus musculus OX=10090 GN=Pdk2 PE=1 SV=2
13	Q02332	2.96e-133	390	401	0.512	0.519	PDHK2_CAEEL Probable [pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pdhk-2 PE=3 SV=1
14	D6RDN9	3.34e-124	361	259	0.406	0.637	D6RDN9_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
15	O82424	1.70e-72	233	364	0.362	0.404	O82424_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 PE=2 SV=1
16	O82423	6.72e-72	231	363	0.352	0.394	O82423_MAIZE Protein-serine/threonine kinase OS=Zea mays OX=4577 GN=541677 PE=2 SV=1
17	Q9SBJ1	3.71e-70	227	366	0.352	0.391	PDK_ARATH [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PDK PE=1 SV=1
18	D6RJH7	1.22e-67	213	141	0.234	0.674	D6RJH7_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
19	D6RHG2	9.09e-60	192	129	0.212	0.667	D6RHG2_HUMAN Protein-serine/threonine kinase (Fragment) OS=Homo sapiens OX=9606 GN=PDK2 PE=1 SV=1
20	Q9P6P9	1.32e-57	196	425	0.271	0.259	PDK_SCHPO [Pyruvate dehydrogenase (acetyl-transferring)] kinase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pkp1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10436 BCDHK_Adom3	2.7e-45	165.6	Mitochondrial branched-chain alpha-ketoacid dehydrogenase kinase
2	PF02518 HATPase_c	7.7e-09	47.4	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
3	PF13589 HATPase_c_3	2.8e+02	12.8	Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010351525.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010380649.1	0.985	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2).
2	61622.XP_010387362.1	0.955	Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial
3	61622.XP_010358789.1	0.924	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial
4	61622.XP_010356673.1	0.872	Pyruvate dehydrogenase complex component X
5	61622.XP_010380738.1	0.854	Dihydrolipoamide dehydrogenase
6	61622.XP_010375891.1	0.820	Pyruvate dehydrogenase kinase 1
7	61622.XP_010383880.1	0.805	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial isoform X1
8	61622.XP_010371458.1	0.717	Mitogen-activated protein kinase kinase kinase 4
9	61622.XP_010368433.1	0.715	Small muscle protein, X-linked
10	61622.XP_010363238.1	0.690	Listerin E3 ubiquitin protein ligase 1
11	61622.XP_010367194.1	0.681	Cat eye syndrome critical region protein 5 isoform X1
12	61622.XP_010377683.1	0.653	Ephrin type-B receptor 6
13	61622.XP_010362368.1	0.648	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. S6 kinase subfamily.
14	61622.XP_010364645.1	0.648	Ribosomal protein S6 kinase beta-2 isoform X1
15	61622.XP_010375534.1	0.643	Dihydrolipoamide branched chain transacylase E2
16	61622.XP_010387670.1	0.632	Kelch like family member 15
17	61622.XP_010386836.1	0.628	Branched chain keto acid dehydrogenase E1 subunit beta
18	61622.XP_010369889.1	0.626	Belongs to the protein kinase superfamily.
19	61622.XP_010381766.1	0.616	Serine/threonine-protein kinase Sgk1 isoform X1
20	61622.XP_010382599.1	0.616	Belongs to the protein kinase superfamily.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004740	1.000	pyruvate dehydrogenase (acetyl-transferring) kinase activity
GO:0005524	1.000	ATP binding
GO:0004674	0.540	protein serine/threonine kinase activity
GO:0042802	0.406	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0008152	0.960	metabolic process
GO:0071704	0.903	organic substance metabolic process
GO:0044238	0.801	primary metabolic process
GO:0050896	0.756	response to stimulus
GO:0065007	0.724	biological regulation
GO:0051716	0.715	cellular response to stimulus
GO:0044237	0.710	cellular metabolic process
GO:0050794	0.689	regulation of cellular process
GO:0019222	0.586	regulation of metabolic process
GO:0006807	0.513	nitrogen compound metabolic process
GO:0007154	0.504	cell communication
GO:0051171	0.504	regulation of nitrogen compound metabolic process
GO:0023052	0.503	signaling
GO:0080090	0.501	regulation of primary metabolic process
GO:0031323	0.500	regulation of cellular metabolic process
GO:1901564	0.379	organonitrogen compound metabolic process
GO:0007165	0.330	signal transduction
GO:0043170	0.328	macromolecule metabolic process
GO:0042221	0.325	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.980	intracellular organelle lumen
GO:0005759	0.664	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23052	1.000	ATP + L-seryl-[pyruvate dehydrogenase E1 alpha subunit] = ADP + H(+) + O-phospho-L-seryl-[pyruvate dehydrogenase E1 alpha subunit]
EC:2.7.11.2	1.000	[pyruvate dehydrogenase (acetyl-transferring)] kinase.

[back to server]