StarFunc result for job id Q15121

User Input

>input (130 residues)
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNL
SYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEI
IKLAPPPKKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AKZ4	0.732	0.732	8.725E-16	130	1.000	1.000	B1AKZ4.pdb.gz	B1AKZ4_HUMAN Astrocytic phosphoprotein PEA-15 OS=Homo sapiens OX=9606 GN=PEA15 PE=2 SV=1
2	PDB:6p6cA	0.475	0.630	2.030E-9	90	0.692	1.000	6p6cA.pdb.gz
3	AFDB:B1AKZ5	0.458	0.548	6.394E-9	108	0.815	0.981	B1AKZ5.pdb.gz	B1AKZ5_HUMAN Proliferation and apoptosis adaptor protein 15 OS=Homo sapiens OX=9606 GN=PEA15 PE=1 SV=1
4	AFDB:Q61160	0.634	0.410	1.572E-3	205	0.177	0.112	Q61160.pdb.gz	FADD_MOUSE FAS-associated death domain protein OS=Mus musculus OX=10090 GN=Fadd PE=1 SV=1
5	AFDB:O89110	0.593	0.168	2.049E-3	480	0.177	0.048	O89110.pdb.gz	CASP8_MOUSE Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1
6	AFDB:Q9JHX4	0.582	0.166	2.161E-3	482	0.177	0.048	Q9JHX4.pdb.gz	CASP8_RAT Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1
7	AFDB:A0A0R4IXF0	0.624	0.430	3.133E-3	192	0.192	0.130	A0A0R4IXF0.pdb.gz	A0A0R4IXF0_DANRE FAS-associated death domain protein OS=Danio rerio OX=7955 GN=fadd PE=1 SV=1
8	AFDB:O75618	0.524	0.228	3.133E-3	318	0.169	0.069	O75618.pdb.gz	DEDD_HUMAN Death effector domain-containing protein OS=Homo sapiens OX=9606 GN=DEDD PE=1 SV=1
9	AFDB:Q8R2E7	0.603	0.390	3.673E-3	208	0.200	0.125	Q8R2E7.pdb.gz	Q8R2E7_RAT FAS-associated death domain protein OS=Rattus norvegicus OX=10116 GN=Fadd PE=1 SV=1
10	AFDB:Q13158	0.609	0.388	4.788E-3	208	0.169	0.106	Q13158.pdb.gz	FADD_HUMAN FAS-associated death domain protein OS=Homo sapiens OX=9606 GN=FADD PE=1 SV=1
11	AFDB:Q92851	0.533	0.139	3.232E-2	521	0.138	0.035	Q92851.pdb.gz	CASPA_HUMAN Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3
12	PDB:5jqeA	0.528	0.145	5.603E-2	544	0.169	0.040	5jqeA.pdb.gz
13	PDB:2bbzA	0.510	0.361	1.456E-1	190	0.146	0.100	2bbzA.pdb.gz
14	PDB:2gf5A	0.544	0.382	1.707E-1	191	0.162	0.110	2gf5A.pdb.gz
15	PDB:5h7nB	0.500	0.157	1.959	460	0.115	0.033	5h7nB.pdb.gz	Design of an expression system to enhance MBP-mediated crystallization
16	PDB:7pzcA	0.446	0.070	2.065	1010	0.169	0.022	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
17	PDB:7wooC	0.239	0.043	2.421	1325	0.154	0.015	7wooC.pdb.gz
18	PDB:3ejbA	0.220	0.347	3.903	78	0.092	0.154	3ejbA.pdb.gz	Structural insights from a P450 Carrier Protein complex reveal how specificity is achieved in the P450(BioI) ACP complex.
19	PDB:7w6sB	0.235	0.095	4.116	448	0.177	0.051	7w6sB.pdb.gz
20	PDB:4m9sB	0.453	0.143	4.340	511	0.138	0.035	4m9sB.pdb.gz	Mechanistic insights into CED-4-mediated activation of CED-3.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AKZ4	1.24e-91	262	130	1.000	1.000	B1AKZ4_HUMAN Astrocytic phosphoprotein PEA-15 OS=Homo sapiens OX=9606 GN=PEA15 PE=2 SV=1
2	Q15121	1.24e-91	262	130	1.000	1.000	PEA15_HUMAN Astrocytic phosphoprotein PEA-15 OS=Homo sapiens OX=9606 GN=PEA15 PE=1 SV=2
3	Q5U318	1.24e-91	262	130	1.000	1.000	PEA15_RAT Astrocytic phosphoprotein PEA-15 OS=Rattus norvegicus OX=10116 GN=Pea15 PE=1 SV=1
4	Q62048	5.04e-91	261	130	0.992	0.992	PEA15_MOUSE Astrocytic phosphoprotein PEA-15 OS=Mus musculus OX=10090 GN=Pea15 PE=1 SV=1
5	B1AKZ5	5.98e-68	202	108	0.823	0.991	B1AKZ5_HUMAN Proliferation and apoptosis adaptor protein 15 OS=Homo sapiens OX=9606 GN=PEA15 PE=1 SV=1
6	Q5QHR8	3.88e-26	96.7	127	0.385	0.394	Q5QHR8_MOUSE Astrocytic phosphoprotein PEA-15 OS=Mus musculus OX=10090 GN=Pea15b-ps PE=2 SV=1
7	Q9JHX4	4.33e-06	46.6	482	0.315	0.085	CASP8_RAT Caspase-8 OS=Rattus norvegicus OX=10116 GN=Casp8 PE=1 SV=1
8	O89110	0.005	37.7	480	0.254	0.069	CASP8_MOUSE Caspase-8 OS=Mus musculus OX=10090 GN=Casp8 PE=1 SV=1
9	Q61160	0.006	37.4	205	0.146	0.093	FADD_MOUSE FAS-associated death domain protein OS=Mus musculus OX=10090 GN=Fadd PE=1 SV=1
10	Q1XBR6	0.034	35.0	182	0.200	0.143	Q1XBR6_BHV4 V-FLIP OS=Bovine herpesvirus 4 OX=10385 GN=ORF71 PE=4 SV=1
11	Q6NVI2	0.083	34.3	278	0.262	0.122	Q6NVI2_HUMAN CASP8 protein OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
12	Q14790	0.12	33.9	479	0.262	0.071	CASP8_HUMAN Caspase-8 OS=Homo sapiens OX=9606 GN=CASP8 PE=1 SV=1
13	Q92851	0.53	32.0	521	0.185	0.046	CASPA_HUMAN Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10 PE=1 SV=3
14	Q54ZW0	0.64	31.6	587	0.277	0.061	PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum OX=44689 GN=phg1b PE=2 SV=1
15	O69687	1.3	30.8	427	0.085	0.026	FAMT_MYCTU Probable fatty acid methyltransferase Rv3720 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3720 PE=1 SV=4
16	Q66I19	3.1	29.6	476	0.246	0.067	Q66I19_DANRE Caspase 8, apoptosis-related cysteine peptidase OS=Danio rerio OX=7955 GN=zgc:92075 PE=1 SV=1
17	P98163	3.2	29.6	1984	0.146	0.010	YL_DROME Putative vitellogenin receptor OS=Drosophila melanogaster OX=7227 GN=yl PE=1 SV=2
18	Q91908	6.4	28.9	2693	0.108	0.005	Q91908_XENLA Inositol 1,4,5-trisphosphate receptor OS=Xenopus laevis OX=8355 GN=itpr1.S PE=1 SV=1
19	Q9I993	6.5	28.9	526	0.162	0.040	BCDO1_CHICK Beta,beta-carotene 15,15'-dioxygenase OS=Gallus gallus OX=9031 GN=BCO1 PE=1 SV=1
20	O62011	9.2	28.5	1054	0.115	0.014	O62011_CAEEL MUTator OS=Caenorhabditis elegans OX=6239 GN=mut-16 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01335 DED	2.4e-16	70.9	Death effector domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 10181.XP_004901592.1

Rank	PPI partner	STRING score	Description
1	10181.XP_004843378.1	0.987	Mitogen-activated protein kinase
2	10181.XP_004856331.1	0.956	Mitogen-activated protein kinase 3
3	10181.XP_004845137.1	0.859	Apoptotic peptidase activating factor 1
4	10181.XP_004852218.1	0.855	Apoptotic adaptor molecule that recruits caspase-8 or caspase-10 to the activated Fas (CD95) or TNFR-1 receptors. The resulting aggregate called the death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation. Active caspase-8 initiates the subsequent cascade of caspases mediating apoptosis. Involved in interferon-mediated antiviral immune response, playing a role in the positive regulation of interferon signaling.
5	10181.XP_004834655.1	0.824	Phospholipase
6	10181.XP_004838787.1	0.674	Receptor-type tyrosine-protein phosphatase epsilon isoform X1
7	10181.XP_004834250.1	0.637	Dual specificity protein phosphatase 7
8	10181.XP_004845100.1	0.629	Receptor-type tyrosine-protein phosphatase R
9	10181.XP_004844548.1	0.612	Cytoplasmic protein NCK2
10	10181.XP_004857340.1	0.608	Phospholipase
11	10181.XP_004845384.1	0.602	Mitogen-activated protein kinase 11 isoform X1
12	10181.XP_004845386.1	0.602	Mitogen-activated protein kinase
13	10181.XP_004846751.1	0.602	Mitogen-activated protein kinase
14	10181.XP_004868835.1	0.602	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
15	10181.XP_004867470.1	0.599	Dual specificity protein phosphatase 10
16	10181.XP_004852093.1	0.588	Inactive serine protease PAMR1 isoform X1
17	10181.XP_004866232.1	0.578	Ribosomal protein S6 kinase alpha-3
18	10181.XP_004839513.1	0.566	Baculoviral IAP repeat-containing protein 6
19	10181.XP_004844710.1	0.562	Hexokinase-2
20	10181.XP_004845538.1	0.538	Single-pass membrane protein with aspartate-rich tail 1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.870	enzyme binding
GO:0019901	0.300	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:1902041	0.989	regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0048523	0.976	negative regulation of cellular process
GO:0009987	0.946	cellular process
GO:0042221	0.939	response to chemical
GO:0043066	0.930	negative regulation of apoptotic process
GO:0048522	0.909	positive regulation of cellular process
GO:2001234	0.907	negative regulation of apoptotic signaling pathway
GO:2001237	0.898	negative regulation of extrinsic apoptotic signaling pathway
GO:0010033	0.897	response to organic substance
GO:0010243	0.866	response to organonitrogen compound
GO:0043279	0.850	response to alkaloid
GO:0014070	0.791	response to organic cyclic compound
GO:0014072	0.724	response to isoquinoline alkaloid
GO:0051716	0.667	cellular response to stimulus
GO:0051049	0.642	regulation of transport
GO:0034762	0.592	regulation of transmembrane transport
GO:1902074	0.501	response to salt
GO:0010827	0.482	regulation of glucose transmembrane transport
GO:0051051	0.458	negative regulation of transport
GO:0046324	0.452	regulation of glucose import
GO:0007154	0.429	cell communication
GO:0023052	0.427	signaling
GO:0010942	0.413	positive regulation of cell death
GO:0043065	0.373	positive regulation of apoptotic process
GO:1901700	0.336	response to oxygen-containing compound
GO:0034763	0.329	negative regulation of transmembrane transport
GO:0043278	0.315	response to morphine
GO:0032502	0.311	developmental process
GO:0032501	0.311	multicellular organismal process
GO:0023056	0.306	positive regulation of signaling
GO:0010647	0.305	positive regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0016020	0.449	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]