StarFunc result for job id Q15124

User Input

>input (567 residues)
MEGSPIPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLRDRQGC
TMVVGSDGRYFSRTAIEIVVQMAAANGIGRLIIGQNGILSTPAVSCIIRKIKAAGGIILT
ASHCPGGPGGEFGVKFNVANGGPAPDVVSDKIYQISKTIEEYAICPDLRIDLSRLGRQEF
DLENKFKPFRVEIVDPVDIYLNLLRTIFDFHAIKGLLTGPSQLKIRIDAMHGVMGPYVRK
VLCDELGAPANSAINCVPLEDFGGQHPDPNLTYATTLLEAMKGGEYGFGAAFDADGDRYM
ILGQNGFFVSPSDSLAIIAANLSCIPYFRQMGVRGFGRSMPTSMALDRVAKSMKVPVYET
PAGWRFFSNLMDSGRCNLCGEESFGTGSDHLREKDGLWAVLVWLSIIAARKQSVEEIVRD
HWAKFGRHYYCRFDYEGLDPKTTYYIMRDLEALVTDKSFIGQQFAVGSHVYSVAKTDSFE
YVDPVDGTVTKKQGLRIIFSDASRLIFRLSSSSGVRATLRLYAESYERDPSGHDQEPQAV
LSPLIAIALKISQIHERTGRRGPTVIT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0R0B3	0.994	0.994	0.000	567	0.769	0.769	B0R0B3.pdb.gz	B0R0B3_DANRE Phosphoglucomutase 5 OS=Danio rerio OX=7955 GN=si:dkey-91m11.4 PE=1 SV=1
2	AFDB:Q15124	1.000	1.000	0.000	567	1.000	1.000	Q15124.pdb.gz	PGM5_HUMAN Phosphoglucomutase-like protein 5 OS=Homo sapiens OX=9606 GN=PGM5 PE=1 SV=2
3	AFDB:P00949	0.982	0.991	1.708E-98	562	0.654	0.660	P00949.pdb.gz	PGM1_RABIT Phosphoglucomutase-1 OS=Oryctolagus cuniculus OX=9986 GN=PGM1 PE=1 SV=2
4	PDB:6snoA	0.972	0.962	2.089E-94	573	0.675	0.668	6snoA.pdb.gz	Structural basis for substrate and product recognition in human phosphoglucomutase-1 (PGM1) isoform 2, a member of the alpha-D-phosphohexomutase superfamily.
5	PDB:5f9cB	0.917	0.969	3.494E-85	536	0.607	0.642	5f9cB.pdb.gz	Induced Structural Disorder as a Molecular Mechanism for Enzyme Dysfunction in Phosphoglucomutase 1 Deficiency.
6	AFDB:Q9VUY9	0.969	0.981	2.753E-83	560	0.490	0.496	Q9VUY9.pdb.gz	PGM_DROME Phosphoglucomutase OS=Drosophila melanogaster OX=7227 GN=Pgm1 PE=1 SV=1
7	AFDB:F4I6W4	0.957	0.821	1.409E-79	662	0.526	0.450	F4I6W4.pdb.gz	F4I6W4_ARATH phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) OS=Arabidopsis thaliana OX=3702 GN=PGM2 PE=1 SV=1
8	AFDB:Q9SCY0	0.940	0.856	3.617E-78	623	0.487	0.443	Q9SCY0.pdb.gz	PGMP_ARATH Phosphoglucomutase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGMP PE=1 SV=2
9	AFDB:P93804	0.950	0.925	4.808E-78	583	0.517	0.503	P93804.pdb.gz	PGMC1_MAIZE Phosphoglucomutase, cytoplasmic 1 OS=Zea mays OX=4577 PE=1 SV=2
10	PDB:7s0wB	0.859	0.974	2.276E-77	499	0.586	0.665	7s0wB.pdb.gz	Effects of the T337M and G391V disease-related variants on human phosphoglucomutase 1: structural disruptions large and small.
11	AFDB:O74374	0.940	0.961	1.022E-73	554	0.471	0.482	O74374.pdb.gz	PGM_SCHPO Phosphoglucomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC32F12.10 PE=1 SV=1
12	AFDB:Q9P931	0.939	0.957	1.522E-73	556	0.441	0.450	Q9P931.pdb.gz	PGM_EMENI Phosphoglucomutase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgmB PE=3 SV=2
13	AFDB:Q6FMJ8	0.933	0.933	1.062E-70	567	0.422	0.422	Q6FMJ8.pdb.gz	Q6FMJ8_CANGA phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PGM1 PE=3 SV=1
14	PDB:4il8A	0.624	0.755	1.387E-21	459	0.169	0.209	4il8A.pdb.gz	Identification of an essential active-site residue in the alpha-D-phosphohexomutase enzyme superfamily.
15	PDB:3c6kD	0.129	0.192	2.917E-3	348	0.035	0.057	3c6kD.pdb.gz	Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
16	PDB:2flhB	0.140	0.395	4.600E-3	153	0.032	0.118	2flhB.pdb.gz	Crystal Structure of Vigna radiata Cytokinin-Specific Binding Protein in Complex with Zeatin.
17	PDB:6xlbC1	0.142	0.241	5.456E-3	284	0.032	0.063	6xlbC1.pdb.gz
18	PDB:4igvA	0.133	0.373	6.115E-3	149	0.037	0.141	4igvA.pdb.gz
19	PDB:3w9rA	0.137	0.311	1.021E-2	171	0.039	0.129	3w9rA.pdb.gz	Mechanism of high-affinity abscisic acid binding to PYL9/RCAR1.
20	PDB:1xl8B	0.131	0.126	1.081E-2	600	0.120	0.113	1xl8B.pdb.gz	Crystal structure of mouse carnitine octanoyltransferase and molecular determinants of substrate selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0R0B3	0.0	943	567	0.771	0.771	B0R0B3_DANRE Phosphoglucomutase 5 OS=Danio rerio OX=7955 GN=si:dkey-91m11.4 PE=1 SV=1
2	F4I6W4	0.0	572	662	0.527	0.452	F4I6W4_ARATH phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) OS=Arabidopsis thaliana OX=3702 GN=PGM2 PE=1 SV=1
3	O49299	0.0	562	583	0.522	0.508	PGMC1_ARATH Probable phosphoglucomutase, cytoplasmic 1 OS=Arabidopsis thaliana OX=3702 GN=At1g23190 PE=2 SV=2
4	P00949	0.0	823	562	0.656	0.662	PGM1_RABIT Phosphoglucomutase-1 OS=Oryctolagus cuniculus OX=9986 GN=PGM1 PE=1 SV=2
5	P36871	0.0	819	562	0.646	0.651	PGM1_HUMAN Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3
6	P38652	0.0	819	562	0.654	0.660	PGM1_RAT Phosphoglucomutase-1 OS=Rattus norvegicus OX=10116 GN=Pgm1 PE=1 SV=2
7	P93804	0.0	571	583	0.517	0.503	PGMC1_MAIZE Phosphoglucomutase, cytoplasmic 1 OS=Zea mays OX=4577 PE=1 SV=2
8	Q15124	0.0	1166	567	1.000	1.000	PGM5_HUMAN Phosphoglucomutase-like protein 5 OS=Homo sapiens OX=9606 GN=PGM5 PE=1 SV=2
9	Q8BZF8	0.0	1146	567	0.975	0.975	PGM5_MOUSE Phosphoglucomutase-like protein 5 OS=Mus musculus OX=10090 GN=Pgm5 PE=1 SV=2
10	Q9D0F9	0.0	820	562	0.654	0.660	PGM1_MOUSE Phosphoglucomutase-1 OS=Mus musculus OX=10090 GN=Pgm1 PE=1 SV=4
11	Q9SCY0	0.0	543	623	0.492	0.448	PGMP_ARATH Phosphoglucomutase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PGMP PE=1 SV=2
12	Q9VUY9	0.0	580	560	0.490	0.496	PGM_DROME Phosphoglucomutase OS=Drosophila melanogaster OX=7227 GN=Pgm1 PE=1 SV=1
13	O74374	2.05e-178	516	554	0.473	0.484	PGM_SCHPO Phosphoglucomutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC32F12.10 PE=1 SV=1
14	Q9P931	2.75e-166	486	556	0.443	0.451	PGM_EMENI Phosphoglucomutase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pgmB PE=3 SV=2
15	P37012	8.68e-162	475	569	0.436	0.434	PGM2_YEAST Phosphoglucomutase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGM2 PE=1 SV=1
16	Q6FMJ8	4.78e-158	465	567	0.425	0.425	Q6FMJ8_CANGA phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent) OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PGM1 PE=3 SV=1
17	P33401	8.21e-153	452	570	0.416	0.414	PGM1_YEAST Phosphoglucomutase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PGM1 PE=1 SV=1
18	P36938	3.73e-15	80.9	546	0.185	0.192	PGM_ECOLI Phosphoglucomutase OS=Escherichia coli (strain K12) OX=83333 GN=pgm PE=1 SV=1
19	P74643	4.21e-15	80.5	567	0.190	0.190	P74643_SYNY3 Phosphoglucomutase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=pgm PE=1 SV=1
20	Q9HV50	5.23e-10	64.3	445	0.162	0.207	GLMM_PSEAE Phosphoglucosamine mutase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=glmM PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02878 PGM_PMM_I	3.3e-25	99.9	Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I
2	PF02879 PGM_PMM_II	6.4e-10	51.0	Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II
3	PF02880 PGM_PMM_III	1.6e-25	100.9	Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III
4	PF00408 PGM_PMM_IV	1.7e+02	13.8	Phosphoglucomutase/phosphomannomutase, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379678

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000229270	0.954	Triosephosphate isomerase 1
2	9606.ENSP00000405573	0.944	Glucose-6-phosphate isomerase
3	9606.ENSP00000354923	0.925	Dystrophin
4	9606.ENSP00000410833	0.901	1,4-alpha-glucan-branching enzyme
5	9606.ENSP00000425809	0.886	Phosphoacetylglucosamine mutase
6	9606.ENSP00000371393	0.869	Phosphoglucomutase-2
7	9606.ENSP00000338703	0.854	UTP--glucose-1-phosphate uridylyltransferase
8	9606.ENSP00000356515	0.849	Utrophin
9	9606.ENSP00000468690	0.810	Uncharacterized protein
10	9606.ENSP00000438144	0.809	Malate dehydrogenase, cytoplasmic
11	9606.ENSP00000264029	0.804	Trehalase
12	9606.ENSP00000473348	0.803	GDH/6PGL endoplasmic bifunctional protein
13	9606.ENSP00000450436	0.783	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
14	9606.ENSP00000338343	0.779	Delta-sarcoglycan
15	9606.ENSP00000242729	0.735	Sarcospan
16	9606.ENSP00000262018	0.735	Alpha-sarcoglycan
17	9606.ENSP00000270142	0.731	Superoxide dismutase [Cu-Zn]
18	9606.ENSP00000341940	0.730	Caveolin-3
19	9606.ENSP00000429842	0.727	Gamma-1-syntrophin
20	9606.ENSP00000164139	0.726	Glycogen phosphorylase, muscle form

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004614	1.000	phosphoglucomutase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.967	organic substance metabolic process
GO:0044238	0.930	primary metabolic process
GO:0044281	0.741	small molecule metabolic process
GO:0005975	0.587	carbohydrate metabolic process
GO:0044237	0.562	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043229	0.998	intracellular organelle
GO:0016020	0.991	membrane
GO:0005886	0.984	plasma membrane
GO:0032991	0.955	protein-containing complex
GO:0043227	0.949	membrane-bounded organelle
GO:0005829	0.905	cytosol
GO:0043232	0.889	intracellular non-membrane-bounded organelle
GO:0031982	0.763	vesicle
GO:0043231	0.727	intracellular membrane-bounded organelle
GO:0005576	0.720	extracellular region
GO:0030016	0.699	myofibril
GO:1903561	0.675	extracellular vesicle
GO:0070062	0.674	extracellular exosome
GO:0030017	0.665	sarcomere
GO:0031674	0.645	I band
GO:0030054	0.605	cell junction
GO:0070161	0.592	anchoring junction
GO:0042383	0.575	sarcolemma
GO:0030055	0.563	cell-substrate junction
GO:0070013	0.402	intracellular organelle lumen
GO:0005856	0.339	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:23536	1.000	alpha-D-glucose 1-phosphate = alpha-D-glucose 6-phosphate
EC:5.4.2.2	1.000	phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent).

[back to server]