StarFunc result for job id Q15139

User Input

>input (912 residues)
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
EMKALGERVSIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F8WBA3	0.554	0.550	0.000	920	1.000	0.991	F8WBA3.pdb.gz	F8WBA3_HUMAN Serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PRKD1 PE=1 SV=1
2	AFDB:A0A2R8RW52	0.512	0.811	2.360E-76	562	0.444	0.721	A0A2R8RW52.pdb.gz
3	PDB:5u6yA	0.272	0.530	4.537E-23	459	0.112	0.222	5u6yA.pdb.gz
4	AFDB:Q9FIM9	0.287	0.436	7.965E-23	594	0.136	0.209	Q9FIM9.pdb.gz	CAMK4_ARATH CDPK-related kinase 4 OS=Arabidopsis thaliana OX=3702 GN=CRK4 PE=1 SV=1
5	AFDB:A0A024R603	0.282	0.670	8.863E-23	370	0.112	0.276	A0A024R603.pdb.gz
6	PDB:2yaaA	0.280	0.817	4.751E-22	300	0.102	0.310	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
7	PDB:6b1uA	0.268	0.541	2.766E-21	442	0.107	0.222	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
8	PDB:5ufuA	0.273	0.653	3.810E-21	369	0.104	0.257	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
9	AFDB:Q9UEE5	0.281	0.606	5.699E-21	414	0.114	0.251	Q9UEE5.pdb.gz	ST17A_HUMAN Serine/threonine-protein kinase 17A OS=Homo sapiens OX=9606 GN=STK17A PE=1 SV=2
10	PDB:4zhxA	0.267	0.580	7.626E-21	409	0.104	0.232	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
11	PDB:3pfqA	0.274	0.469	1.301E-20	523	0.132	0.229	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
12	AFDB:Q9LJL9	0.281	0.422	1.844E-20	599	0.124	0.189	Q9LJL9.pdb.gz	CAMK2_ARATH CDPK-related kinase 2 OS=Arabidopsis thaliana OX=3702 GN=CRK2 PE=1 SV=1
13	AFDB:O94768	0.279	0.667	2.827E-20	372	0.095	0.234	O94768.pdb.gz	ST17B_HUMAN Serine/threonine-protein kinase 17B OS=Homo sapiens OX=9606 GN=STK17B PE=1 SV=1
14	PDB:7myjC	0.268	0.514	4.439E-20	465	0.098	0.191	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
15	AFDB:Q8MZC6	0.271	0.579	5.085E-20	411	0.084	0.187	Q8MZC6.pdb.gz	Q8MZC6_DROME Doublecortin-like and CAM kinase-like protein OS=Drosophila melanogaster OX=7227 GN=CG10177 PE=2 SV=1
16	AFDB:Q9CAD5	0.269	0.277	1.132E-19	883	0.151	0.156	Q9CAD5.pdb.gz	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
17	PDB:4rerA	0.270	0.524	1.515E-19	459	0.111	0.220	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
18	PDB:6byrA	0.276	0.607	2.087E-19	405	0.099	0.222	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.
19	PDB:4rewA	0.278	0.600	2.202E-19	411	0.114	0.253	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	AFDB:O55173	0.282	0.450	2.960E-19	559	0.106	0.174	O55173.pdb.gz	PDPK1_RAT 3-phosphoinositide-dependent protein kinase 1 OS=Rattus norvegicus OX=10116 GN=Pdpk1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHC3	0.0	846	906	0.492	0.496	A0A0B4KHC3_DROME Serine/threonine-protein kinase OS=Drosophila melanogaster OX=7227 GN=PKD PE=3 SV=1
2	D4A229	0.0	1250	890	0.684	0.701	D4A229_RAT Serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Prkd3 PE=1 SV=1
3	F8WBA3	0.0	1894	920	1.000	0.991	F8WBA3_HUMAN Serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PRKD1 PE=1 SV=1
4	O45818	0.0	827	1070	0.480	0.409	DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans OX=6239 GN=dkf-2 PE=1 SV=4
5	O94806	0.0	1261	890	0.686	0.703	KPCD3_HUMAN Serine/threonine-protein kinase D3 OS=Homo sapiens OX=9606 GN=PRKD3 PE=1 SV=1
6	Q15139	0.0	1902	912	1.000	1.000	KPCD1_HUMAN Serine/threonine-protein kinase D1 OS=Homo sapiens OX=9606 GN=PRKD1 PE=1 SV=2
7	Q62101	0.0	1654	918	0.890	0.885	KPCD1_MOUSE Serine/threonine-protein kinase D1 OS=Mus musculus OX=10090 GN=Prkd1 PE=1 SV=2
8	Q8BZ03	0.0	1227	875	0.675	0.704	KPCD2_MOUSE Serine/threonine-protein kinase D2 OS=Mus musculus OX=10090 GN=Prkd2 PE=1 SV=1
9	Q9BZL6	0.0	1220	878	0.673	0.699	KPCD2_HUMAN Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2 PE=1 SV=3
10	Q9VE91	0.0	847	836	0.492	0.537	Q9VE91_DROME Serine/threonine-protein kinase OS=Drosophila melanogaster OX=7227 GN=PKD PE=2 SV=4
11	Q9WTQ1	0.0	1659	918	0.894	0.888	KPCD1_RAT Serine/threonine-protein kinase D1 OS=Rattus norvegicus OX=10116 GN=Prkd1 PE=1 SV=2
12	X1WHC7	0.0	1489	886	0.799	0.823	X1WHC7_DANRE Serine/threonine-protein kinase OS=Danio rerio OX=7955 GN=prkd1 PE=3 SV=1
13	Q9XUJ7	3.29e-161	491	722	0.344	0.435	DKF1_CAEEL Serine/threonine-protein kinase dkf-1 OS=Caenorhabditis elegans OX=6239 GN=dkf-1 PE=1 SV=1
14	P25323	3.13e-60	209	295	0.120	0.369	MYLKA_DICDI Myosin light chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mlkA PE=1 SV=2
15	O96017	5.31e-54	199	543	0.128	0.215	CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens OX=9606 GN=CHEK2 PE=1 SV=1
16	Q9Z265	3.09e-53	197	546	0.121	0.201	CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus OX=10090 GN=Chek2 PE=1 SV=1
17	Q8BW96	5.78e-50	183	385	0.107	0.255	KCC1D_MOUSE Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2
18	A1EAT1	1.44e-49	186	522	0.121	0.211	A1EAT1_CHICK Checkpoint and tumor suppressor protein 2 OS=Gallus gallus OX=9031 GN=CHEK2 PE=1 SV=1
19	Q8IU85	1.75e-49	182	385	0.107	0.255	KCC1D_HUMAN Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D PE=1 SV=1
20	E7F1H0	2.54e-49	181	382	0.110	0.262	E7F1H0_DANRE Calcium/calmodulin-dependent protein kinase Ib OS=Danio rerio OX=7955 GN=camk1b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.0028	28.4	ABC1 atypical kinase-like domain
2	PF01636 APH	4.2e+02	12.2	Phosphotransferase enzyme family
3	PF00130 C1_1	1.6e-25	100.1	Phorbol esters/diacylglycerol binding domain (C1 domain)
4	PF03107 C1_2	0.051	25.2	C1 domain
5	PF06293 Kdo	0.21	22.5	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	0.0055	27.7	Kinase-like
7	PF00169 PH	5.9e-07	41.3	PH domain
8	PF00069 Pkinase	2.8e-67	238.5	Protein kinase domain
9	PF07714 PK_Tyr_Ser-Thr	7.1e-30	115.7	Protein tyrosine and serine/threonine kinase
10	PF13901 zf-RING_9	68	14.8	Putative zinc-RING and/or ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333568

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354718	0.980	A-kinase anchor protein 13
2	9606.ENSP00000369862	0.972	Collagen type IV alpha-3-binding protein
3	9606.ENSP00000426909	0.940	Receptor of activated protein C kinase 1
4	9606.ENSP00000225983	0.927	Histone deacetylase 5
5	9606.ENSP00000302665	0.926	Insulin-like growth factor I
6	9606.ENSP00000268035	0.924	Insulin-like growth factor 1 receptor
7	9606.ENSP00000304895	0.917	Insulin receptor substrate 1
8	9606.ENSP00000401303	0.917	SHC-transforming protein 1
9	9606.ENSP00000376345	0.913	Growth factor receptor-bound protein 2
10	9606.ENSP00000387784	0.909	Son of sevenless homolog 1
11	9606.ENSP00000261769	0.908	Cadherin-1
12	9606.ENSP00000262613	0.907	Na(+)/H(+) exchange regulatory cofactor NHE-RF1
13	9606.ENSP00000456226	0.905	Interferon induced transmembrane protein domain containing
14	9606.ENSP00000408695	0.848	Protein kinase C alpha type
15	9606.ENSP00000267257	0.832	Paxillin
16	9606.ENSP00000305355	0.832	Protein kinase C beta type
17	9606.ENSP00000263431	0.825	Protein kinase C gamma type
18	9606.ENSP00000358723	0.817	Ras-related protein Rap-1A
19	9606.ENSP00000440005	0.817	ADP-ribosylation factor 1
20	9606.ENSP00000080059	0.809	Histone deacetylase 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004674	1.000	protein serine/threonine kinase activity
GO:0019899	0.798	enzyme binding
GO:0019900	0.417	kinase binding
GO:0004697	0.336	protein kinase C activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.993	cellular process
GO:0050896	0.992	response to stimulus
GO:0050793	0.957	regulation of developmental process
GO:0048518	0.950	positive regulation of biological process
GO:0019222	0.950	regulation of metabolic process
GO:0071704	0.944	organic substance metabolic process
GO:1901342	0.942	regulation of vasculature development
GO:0023052	0.940	signaling
GO:0007154	0.937	cell communication
GO:0051716	0.937	cellular response to stimulus
GO:0044238	0.936	primary metabolic process
GO:0044237	0.935	cellular metabolic process
GO:0048522	0.924	positive regulation of cellular process
GO:0006807	0.867	nitrogen compound metabolic process
GO:0019538	0.862	protein metabolic process
GO:0007165	0.849	signal transduction
GO:0022603	0.816	regulation of anatomical structure morphogenesis
GO:0035556	0.814	intracellular signal transduction
GO:0006796	0.810	phosphate-containing compound metabolic process
GO:0045765	0.805	regulation of angiogenesis
GO:0036211	0.793	protein modification process
GO:0006468	0.751	protein phosphorylation
GO:0080090	0.743	regulation of primary metabolic process
GO:0060255	0.719	regulation of macromolecule metabolic process
GO:0031323	0.699	regulation of cellular metabolic process
GO:0051171	0.651	regulation of nitrogen compound metabolic process
GO:0048583	0.606	regulation of response to stimulus
GO:0009893	0.606	positive regulation of metabolic process
GO:0031325	0.532	positive regulation of cellular metabolic process
GO:0010604	0.526	positive regulation of macromolecule metabolic process
GO:0009966	0.525	regulation of signal transduction
GO:0018107	0.504	peptidyl-threonine phosphorylation
GO:0051173	0.466	positive regulation of nitrogen compound metabolic process
GO:0010468	0.462	regulation of gene expression
GO:0031326	0.446	regulation of cellular biosynthetic process
GO:0010556	0.442	regulation of macromolecule biosynthetic process
GO:0019219	0.442	regulation of nucleobase-containing compound metabolic process
GO:0051246	0.429	regulation of protein metabolic process
GO:0048519	0.425	negative regulation of biological process
GO:0048523	0.412	negative regulation of cellular process
GO:0042221	0.402	response to chemical
GO:0048584	0.381	positive regulation of response to stimulus
GO:0042127	0.368	regulation of cell population proliferation
GO:0032501	0.355	multicellular organismal process
GO:0050678	0.340	regulation of epithelial cell proliferation
GO:2000147	0.335	positive regulation of cell motility
GO:0031399	0.334	regulation of protein modification process
GO:0030335	0.334	positive regulation of cell migration
GO:0065009	0.332	regulation of molecular function
GO:0006950	0.328	response to stress
GO:0051252	0.326	regulation of RNA metabolic process
GO:0006355	0.319	regulation of DNA-templated transcription
GO:0010634	0.309	positive regulation of epithelial cell migration
GO:1902531	0.303	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005886	0.995	plasma membrane
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005634	0.953	nucleus
GO:0012505	0.825	endomembrane system
GO:0031981	0.533	nuclear lumen
GO:0005654	0.505	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
EC:2.7.11.13	0.336	protein kinase C.

[back to server]