StarFunc result for job id Q15147

User Input

>input (1175 residues)
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWRSEGKEGQVL
ECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRALPSPNDLKRKILIKNKRLKPEVEKKQLEALRSM
MEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQAKEMQQMVKLEAEMDRRPATVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5EBH0	0.681	0.561	0.000	1431	0.506	0.415	G5EBH0.pdb.gz	PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans OX=6239 GN=egl-8 PE=1 SV=1
2	AFDB:P13217	0.669	0.717	0.000	1095	0.508	0.545	P13217.pdb.gz	PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=norpA PE=1 SV=4
3	AFDB:Q15147	1.000	1.000	0.000	1175	1.000	1.000	Q15147.pdb.gz	PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3
4	AFDB:P10687	0.625	0.605	3.618E-101	1216	0.388	0.375	P10687.pdb.gz	PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus OX=10116 GN=Plcb1 PE=1 SV=1
5	AFDB:A0A0R4IVA6	0.626	0.592	2.857E-96	1245	0.379	0.357	A0A0R4IVA6.pdb.gz	A0A0R4IVA6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Danio rerio OX=7955 GN=Plcbeta3 PE=1 SV=2
6	AFDB:Q91086	0.630	0.612	1.008E-94	1211	0.360	0.349	Q91086.pdb.gz	Q91086_MELGA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Meleagris gallopavo OX=9103 PE=1 SV=1
7	AFDB:P51432	0.627	0.598	1.643E-94	1234	0.371	0.353	P51432.pdb.gz	PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus OX=10090 GN=Plcb3 PE=1 SV=2
8	AFDB:P25455	0.627	0.560	3.417E-94	1318	0.378	0.337	P25455.pdb.gz	PIP1_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase classes I and II OS=Drosophila melanogaster OX=7227 GN=Plc21C PE=2 SV=3
9	AFDB:Q00722	0.627	0.622	1.539E-92	1185	0.342	0.339	Q00722.pdb.gz	PLCB2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens OX=9606 GN=PLCB2 PE=1 SV=2
10	AFDB:O89040	0.623	0.619	2.256E-91	1183	0.345	0.342	O89040.pdb.gz	PLCB2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Rattus norvegicus OX=10116 GN=Plcb2 PE=2 SV=1
11	PDB:4gnkB	0.619	0.937	3.077E-80	769	0.314	0.480	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:1cjyA	0.089	0.162	4.220E-5	633	0.022	0.041	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
13	PDB:5izrC	0.086	0.149	3.616E-4	659	0.020	0.035	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:5ixcA	0.086	0.145	3.987E-4	684	0.018	0.031	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
15	PDB:7lq1A	0.087	0.105	8.291E-4	950	0.022	0.027	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
16	PDB:5iz5B	0.087	0.133	1.167E-3	746	0.017	0.027	5iz5B.pdb.gz
17	PDB:5iz5A	0.085	0.130	1.287E-3	757	0.015	0.024	5iz5A.pdb.gz
18	PDB:6pyuA	0.087	0.108	4.152E-3	930	0.022	0.028	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.
19	PDB:4ajwB	0.083	0.119	7.104E-3	792	0.021	0.032	4ajwB.pdb.gz	Discovery and Optimization of New Benzimidazole- and Benzoxazole-Pyrimidone Selective Pi3Kbeta Inhibitors for the Treatment of Phosphatase and Tensin Homologue (Pten)-Deficient Cancers.
20	PDB:7o4i1	0.074	0.152	1.215E-2	522	0.040	0.090	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IVA6	776	1245	0.392	0.370	A0A0R4IVA6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Danio rerio OX=7955 GN=Plcbeta3 PE=1 SV=2
2	A2AT91	1806	883	0.727	0.967	A2AT91_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
3	A2TJ25	777	1244	0.392	0.371	A2TJ25_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Danio rerio OX=7955 GN=Plcbeta3 PE=1 SV=1
4	A3KGF7	692	1181	0.351	0.350	PLCB2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Mus musculus OX=10090 GN=Plcb2 PE=1 SV=1
5	G1MWY7	698	907	0.326	0.422	G1MWY7_MELGA Phosphoinositide phospholipase C OS=Meleagris gallopavo OX=9103 PE=4 SV=2
6	G5EBH0	650	1431	0.299	0.245	PLCB_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta egl-8 OS=Caenorhabditis elegans OX=6239 GN=egl-8 PE=1 SV=1
7	O89040	694	1183	0.351	0.348	PLCB2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Rattus norvegicus OX=10116 GN=Plcb2 PE=2 SV=1
8	P10687	795	1216	0.365	0.353	PLCB1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Rattus norvegicus OX=10116 GN=Plcb1 PE=1 SV=1
9	P13217	1160	1095	0.508	0.545	PIPA_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Drosophila melanogaster OX=7227 GN=norpA PE=1 SV=4
10	P51432	726	1234	0.375	0.357	PLCB3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Mus musculus OX=10090 GN=Plcb3 PE=1 SV=2
11	Q00722	694	1185	0.349	0.346	PLCB2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens OX=9606 GN=PLCB2 PE=1 SV=2
12	Q01970	763	1234	0.392	0.374	PLCB3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3 PE=1 SV=2
13	Q15147	2456	1175	1.000	1.000	PLCB4_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 OS=Homo sapiens OX=9606 GN=PLCB4 PE=1 SV=3
14	Q5FWA6	1807	892	0.728	0.959	Q5FWA6_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=2 SV=1
15	Q6P8L2	946	463	0.376	0.955	Q6P8L2_MOUSE Phosphoinositide phospholipase C (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=2 SV=1
16	Q8BXH1	737	368	0.308	0.984	Q8BXH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (Fragment) OS=Mus musculus OX=10090 GN=Plcb4 PE=2 SV=2
17	Q91086	726	1211	0.383	0.372	Q91086_MELGA 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Meleagris gallopavo OX=9103 PE=1 SV=1
18	Q91UZ1	2414	1175	0.980	0.980	Q91UZ1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase OS=Mus musculus OX=10090 GN=Plcb4 PE=1 SV=1
19	Q99JE6	709	1234	0.374	0.356	PLCB3_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Rattus norvegicus OX=10116 GN=Plcb3 PE=1 SV=2
20	Q9NQ66	799	1216	0.365	0.353	PLCB1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 OS=Homo sapiens OX=9606 GN=PLCB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	5.8e-05	34.7	C2 domain
2	PF06631 DUF1154	3e-15	67.1	Protein of unknown function (DUF1154)
3	PF13405 EF-hand_6	5.3e+02	11.9	EF-hand domain
4	PF13499 EF-hand_7	9.3e+02	11.7	EF-hand domain pair
5	PF09279 EF-hand_like	5.7e-10	50.9	Phosphoinositide-specific phospholipase C, efhand-like
6	PF17787 PH_14	9.1e-45	163.1	PH domain
7	PF00388 PI-PLC-X	1.3e-58	208.1	Phosphatidylinositol-specific phospholipase C, X domain
8	PF00387 PI-PLC-Y	4.5e-36	135.1	Phosphatidylinositol-specific phospholipase C, Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 29073.XP_008701564.1

Rank	PPI partner	STRING score	Description
1	29073.XP_008693896.1	0.963	Phosphatidylinositol-4-phosphate 5-kinase type 1 alpha
2	29073.XP_008689162.1	0.960	Phosphatidylinositol-4-phosphate 5-kinase type 1 beta
3	29073.XP_008697126.1	0.959	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
4	29073.XP_008709629.1	0.957	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
5	29073.XP_008682580.1	0.953	Phosphatidylinositol 5-phosphate 4-kinase type-2 gamma
6	29073.XP_008687176.1	0.953	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta isoform X1
7	29073.XP_008690294.1	0.953	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
8	29073.XP_008689196.1	0.951	Guanine nucleotide-binding protein G(q) subunit alpha
9	29073.XP_008709617.1	0.951	Guanine nucleotide-binding protein subunit alpha-11
10	29073.XP_008709466.1	0.939	G protein subunit alpha 15
11	29073.XP_008684399.1	0.912	G protein subunit alpha transducin 3
12	29073.XP_008706394.1	0.887	Calcium sensing receptor
13	29073.XP_008689194.1	0.877	Guanine nucleotide-binding protein subunit alpha-14
14	29073.XP_008684516.1	0.876	Guanine nucleotide-binding protein G(i) subunit alpha-1
15	29073.XP_008702242.1	0.876	Guanine nucleotide-binding protein G(k) subunit alpha
16	29073.XP_008689398.1	0.868	G-protein coupled receptor family C group 6 member A isoform X1
17	29073.XP_008701984.1	0.862	G protein subunit alpha i2
18	29073.XP_008691724.1	0.850	Inositol 1,4,5-trisphosphate receptor type 3
19	29073.XP_008704204.1	0.844	G protein subunit beta 5
20	29073.XP_008696163.1	0.842	Inositol 1,4,5-trisphosphate receptor type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004629	0.999	phospholipase C activity
GO:0004435	0.876	phosphatidylinositol phospholipase C activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0050789	0.994	regulation of biological process
GO:0050794	0.982	regulation of cellular process
GO:0099177	0.715	regulation of trans-synaptic signaling
GO:0009987	0.714	cellular process
GO:0051716	0.648	cellular response to stimulus
GO:0023052	0.626	signaling
GO:0007154	0.626	cell communication
GO:0007165	0.624	signal transduction
GO:0050804	0.408	modulation of chemical synaptic transmission

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005737	0.999	cytoplasm
GO:0012505	0.995	endomembrane system
GO:0120025	0.993	plasma membrane bounded cell projection
GO:0005634	0.990	nucleus
GO:0030054	0.982	cell junction
GO:0043005	0.965	neuron projection
GO:0045202	0.962	synapse
GO:0014069	0.951	postsynaptic density
GO:0098978	0.950	glutamatergic synapse
GO:0098688	0.948	parallel fiber to Purkinje cell synapse
GO:0005886	0.947	plasma membrane
GO:0097447	0.946	dendritic tree
GO:0005790	0.945	smooth endoplasmic reticulum
GO:0030425	0.939	dendrite
GO:0005829	0.814	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.4.-	0.999	Phosphoric diester hydrolases.
RHEA:33179	0.876	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.876	phosphoinositide phospholipase C.

[back to server]