StarFunc result for job id Q15149

User Input

>input (1400 residues)
MVAGMLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGL
VRETFAWCHFYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQ
GPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRV
QKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNV
QIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEK
LLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPLLIDMNKVYRQTNLENLDQAF
SVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVRANELQLRWQE
YRELVLLLLQWMRHHTAAFEERRFPSSFEEIEILWSQFLKFKEMELPAKEADKNRSKGIY
QSLEGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRIVTKLQM
EAGLCEEQLNQADALLQSDVRLLAAGKVPQRAGEVERDLDKADSMIRLLFNDVQTLKDGR
HPQGEQMYRRVYRLHERLVAIRTEYNLRLKAGVAAPATQVAQVTLQSVQRRPELEDSTLR
YLQDLLAWVEENQHRVDGAEWGVDLPSVEAQLGSHRGLHQSIEEFRAKIERARSDEGQLS
PATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHSFVAAATKELMWLNEKEEEEVGFD
WSDRNTNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQ
WSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYSCDRSATVTRLEDL
LQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVCDYKQVEVTVH
KGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLW
HQLHVDMKSLLAWQSLRRDVQLIRSWSLATFRTLKPEEQRQALHSLELHYQAFLRDSQDA
GGFGPEDRLMAEREYGSCSHHYQQLLQSLEQGAQEESRCQRCISELKDIRLQLEACETRT
VHRLRLPLDKEPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTL
RSELELTLGKLEQVRSLSAIYLEKLKTISLVIRGTQGAEEVLRAHEEQLKEAQAVPATLP
ELEATKASLKKLRAQAEAQQPTFDALRDELRGAQEVGERLQQRHGERDVEVERWRERVAQ
LLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLGAWLQDARRRQEQIQAMPLADSQA
VREQLRQEQALLEEIERHGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q503P9	0.176	0.310	9.454E-77	786	0.412	0.734	Q503P9.pdb.gz
2	AFDB:P11277	0.162	0.107	4.021E-40	2137	0.222	0.146	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
3	AFDB:O15020	0.164	0.097	1.539E-39	2390	0.215	0.126	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
4	AFDB:Q00963	0.164	0.109	2.702E-39	2291	0.220	0.134	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
5	AFDB:F1QQE5	0.157	0.094	3.790E-38	2357	0.220	0.131	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
6	AFDB:Q01082	0.160	0.096	4.133E-38	2364	0.220	0.130	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
7	AFDB:Q9H254	0.159	0.095	6.786E-35	2564	0.219	0.119	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
8	AFDB:Q13696	0.167	0.597	9.296E-31	385	0.154	0.558	Q13696.pdb.gz	Q13696_HUMAN ACF7 protein (Fragment) OS=Homo sapiens OX=9606 GN=ACF7 PE=4 SV=1
9	AFDB:P57780	0.158	0.242	4.383E-29	912	0.140	0.215	P57780.pdb.gz	ACTN4_MOUSE Alpha-actinin-4 OS=Mus musculus OX=10090 GN=Actn4 PE=1 SV=1
10	AFDB:B2R8Y4	0.161	0.248	9.555E-29	901	0.148	0.230	B2R8Y4.pdb.gz	B2R8Y4_HUMAN cDNA, FLJ94117, highly similar to Homo sapiens actinin, alpha 3 (ACTN3), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
11	PDB:4d1eA	0.155	0.251	1.846E-22	859	0.124	0.201	4d1eA.pdb.gz
12	PDB:1sjjA	0.132	0.203	1.072E-19	863	0.126	0.204	1sjjA.pdb.gz
13	PDB:7qp6a	0.065	0.852	2.640E-7	99	0.046	0.657	7qp6a.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
14	PDB:4v6wAK	0.066	0.890	1.368E-6	95	0.039	0.568	4v6wAK.pdb.gz	Structures of the human and Drosophila 80S ribosome.
15	PDB:5datC0	0.065	0.890	1.093E-5	96	0.029	0.427	5datC0.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
16	PDB:7pzyL	0.064	0.926	3.674E-5	93	0.026	0.387	7pzyL.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
17	PDB:7sx8D	0.134	0.365	4.184E-5	448	0.037	0.116	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
18	PDB:4v8mAD	0.063	0.739	1.904E-4	103	0.027	0.369	4v8mAD.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:1tr2B	0.070	0.086	9.790E-3	1029	0.095	0.129	1tr2B.pdb.gz
20	PDB:7t3uC	0.072	0.070	1.022E-2	1575	0.106	0.094	7t3uC.pdb.gz	Structural basis for activation and gating of IP 3 receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4K7P8	647	5394	0.301	0.078	A0A0B4K7P8_DROME Short stop, isoform Z OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
2	A0A0B4K7Y9	641	5408	0.301	0.078	A0A0B4K7Y9_DROME Short stop, isoform AA OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
3	A0A0R4IJ71	1781	4506	0.586	0.182	A0A0R4IJ71_DANRE Plectin b OS=Danio rerio OX=7955 GN=si:ch211-165e15.1 PE=1 SV=2
4	A0A286YBE9	1827	4773	0.606	0.178	A0A286YBE9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
5	A0A2R8PVX9	1828	4580	0.606	0.185	A0A2R8PVX9_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
6	A0A2R8RIJ1	1826	4599	0.606	0.185	A0A2R8RIJ1_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
7	A1Z9I8	652	5385	0.301	0.078	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
8	A1Z9I9	653	5390	0.301	0.078	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
9	A1Z9J0	653	5201	0.310	0.083	A1Z9J0_DROME Short stop, isoform E OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
10	A1Z9J1	652	5501	0.307	0.078	A1Z9J1_DROME Short stop, isoform A OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
11	A5WV02	1837	4577	0.606	0.185	A5WV02_DANRE Plectin OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1
12	B7YZG2	652	5370	0.301	0.078	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
13	B7YZG3	652	5375	0.301	0.078	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
14	B7YZG4	652	5368	0.301	0.078	B7YZG4_DROME Short stop, isoform J OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
15	B7YZG5	653	5486	0.307	0.078	B7YZG5_DROME Short stop, isoform L OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
16	B7YZG6	652	5479	0.307	0.078	B7YZG6_DROME Short stop, isoform M OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
17	D3ZHV2	1179	5430	0.427	0.110	MACF1_RAT Microtubule-actin cross-linking factor 1 OS=Rattus norvegicus OX=10116 GN=Macf1 PE=1 SV=1
18	E1JH62	653	5388	0.301	0.078	E1JH62_DROME Short stop, isoform N OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	E1JH63	652	5499	0.307	0.078	E1JH63_DROME Short stop, isoform O OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	E7F8G7	1835	4762	0.606	0.178	E7F8G7_DANRE Plectin a OS=Danio rerio OX=7955 GN=fa95h11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	0.0098	27.0	CAMSAP CH domain
2	PF00307 CH	2.7e-44	161.2	Calponin homology (CH) domain
3	PF09828 Chrome_Resist	2.1e+02	13.7	Chromate resistance exported protein
4	PF03501 S10_plectin	3.5e-31	118.4	Plectin/S10 domain
5	PF17902 SH3_10	8.6e-15	65.9	SH3 domain
6	PF00435 Spectrin	3.8e-11	54.7	Spectrin repeat
7	PF18373 Spectrin_like	2.5e-22	90.1	Spectrin like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323856

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000200181	0.999	Integrin beta-4
2	9606.ENSP00000426909	0.997	Receptor of activated protein C kinase 1
3	9606.ENSP00000435370	0.993	Ubiquitin-like protein FUBI
4	9606.ENSP00000340937	0.992	Collagen alpha-1(XVII) chain
5	9606.ENSP00000334308	0.989	Nesprin-3
6	9606.ENSP00000351273	0.957	Caspase-8
7	9606.ENSP00000472469	0.943	Ribosomal protein S28
8	9606.ENSP00000419117	0.942	60S ribosomal protein L35a
9	9606.ENSP00000467466	0.942	Ribosomal protein S15
10	9606.ENSP00000429374	0.941	Ribosomal protein S20
11	9606.ENSP00000447001	0.941	60S ribosomal protein L18
12	9606.ENSP00000296674	0.940	40S ribosomal protein S23
13	9606.ENSP00000309334	0.939	Ribosomal protein L15
14	9606.ENSP00000464813	0.937	60S ribosomal protein L27
15	9606.ENSP00000251453	0.936	Ribosomal protein S16
16	9606.ENSP00000386717	0.936	Ribosomal protein L31
17	9606.ENSP00000341885	0.933	Ribosomal protein S2
18	9606.ENSP00000379888	0.933	Ribosomal protein S8
19	9606.ENSP00000225430	0.932	Ribosomal protein L19
20	9606.ENSP00000428085	0.932	Ribosomal protein L30

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.999	cytoskeletal protein binding
GO:0003779	0.983	actin binding
GO:0005198	0.943	structural molecule activity
GO:0030506	0.813	ankyrin binding
GO:1901363	0.712	heterocyclic compound binding
GO:0097159	0.706	organic cyclic compound binding
GO:0003723	0.687	RNA binding
GO:0005200	0.349	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0071840	0.630	cellular component organization or biogenesis
GO:0016043	0.524	cellular component organization
GO:0022607	0.486	cellular component assembly
GO:0032501	0.472	multicellular organismal process
GO:0034330	0.403	cell junction organization
GO:0032502	0.383	developmental process
GO:0048856	0.359	anatomical structure development
GO:0034329	0.328	cell junction assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.995	cytoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0016020	0.988	membrane
GO:0071944	0.978	cell periphery
GO:0005829	0.907	cytosol
GO:0043227	0.901	membrane-bounded organelle
GO:0005886	0.835	plasma membrane
GO:0099080	0.712	supramolecular complex
GO:0099081	0.633	supramolecular polymer
GO:0030016	0.623	myofibril
GO:0030054	0.620	cell junction
GO:0070161	0.605	anchoring junction
GO:0042383	0.544	sarcolemma
GO:0030055	0.526	cell-substrate junction
GO:0005856	0.499	cytoskeleton
GO:0005925	0.458	focal adhesion
GO:0043230	0.425	extracellular organelle
GO:1903561	0.418	extracellular vesicle
GO:0070062	0.410	extracellular exosome
GO:0043231	0.393	intracellular membrane-bounded organelle
GO:0012505	0.317	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]