StarFunc result for job id Q15154

User Input

>input (2024 residues)
MATGGGPFEDGMNDQDLPNWSNENVDDRLNNMDWGAQQKKANRSSEKNKKKFGVESDKRV
TNDISPESSPGVGRRRTKTPHTFPHSRYMSQMSVPEQAELEKLKQRINFSDLDQRSIGSD
SQGRATAANNKRQLSENRKPFNFLPMQINTNKSKDASTNPPNRETIGSAQCKELFASALS
NDLLQNCQVSEEDGRGEPAMESSQIVSRLVQIRDYITKASSMREDLVEKNERSANVERLT
HLIDHLKEQEKSYMKFLKKILARDPQQEPMEEIENLKKQHDLLKRMLQQQEQLRALQGRQ
AALLALQHKAEQAIAVMDDSVVAETAGSLSGVSITSELNEELNDLIQRFHNQLRDSQPPA
VPDNRRQAESLSLTREVSQSRKPSASERLPDEKVELFSKMRVLQEKKQKMDKLLGELHTL
RDQHLNNSSASPQRSVDQRSTSAPSASVGLAPVVNGESNSLTSSVPYPTASLVSQNESEN
EGHLNPSEKLQKLNEVRKRLNELRELVHYYEQTSDMMTDAVNENRKDEETEESEYDSEHE
NSEPVTNIRNPQVASTWNEVNSHSNAQCVSNNRDGRTVNSNCEINNRSAANIRALNMPPS
LDCRYNREGEQEIHVAQGEDDEEEEEEAEEEGVSGASLSSHRSSLVDEHPEDAEFEQKIN
RLMAAKQKLRQLQDLVAMVQDDDAAQGVISASASNLDDFYPAEEDTKQNSNNTRGNANKT
QKDTGVNEKAREKFYEAKLQQQQRELKQLQEERKKLIDIQEKIQALQTACPDLQLSAASV
GNCPTKKYMPAVTSTPTVNQHETSTSKSVFEPEDSSIVDNELWSEMRRHEMLREELRQRR
KQLEALMAEHQRRQGLAETASPVAVSLRSDGSENLCTPQQSRTEKTMATWGGSTQCALDE
EGDEDGYLSEGIVRTDEEEEEEQDASSNDNFSVCPSNSVNHNSYNGKETKNRWKNNCPFS
ADENYRPLAKTRQQNISMQRQENLRWVSELSYVEEKEQWQEQINQLKKQLDFSVSICQTL
MQDQQTLSCLLQTLLTGPYSVMPSNVASPQVHFIMHQLNQCYTQLTWQQNNVQRLKQMLN
ELMRQQNQHPEKPGGKERGSSASHPPSPSLFCPFSFPTQPVNLFNIPGFTNFSSFAPGMN
FSPLFPSNFGDFSQNISTPSEQQQPLAQNSSGKTEYMAFPKPFESSSSIGAEKPRNKKLP
EEEVESSRTPWLYEQEGEVEKPFIKTGFSVSVEKSTSSNRKNQLDTNGRRRQFDEESLES
FSSMPDPVDPTTVTKTFKTRKASAQASLASKDKTPKSKSKKRNSTQLKSRVKNIRYESAS
MSSTCEPCKSRNRHSAQTEEPVQAKVFSRKNHEQLEKIIKCNRSTEISSETGSDFSMFEA
LRDTIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYALQDIVSRHISESHEK
GENVKSVNSGTWIASNSELTPSESLATTDDETFEKNFERETHKISEQNDADNASVLSVSS
NFEPFATDDLGNTVIHLDQALARMREYERMKTEAESNSNMRCTCRIIEDGDGAGAGTTVN
NLEETPVIENRSSQQPVSEVSTIPCPRIDTQQLDRQIKAIMKEVIPFLKEHMDEVCSSQL
LTSVRRMVLTLTQQNDESKEFVKFFHKQLGSILQDSLAKFAGRKLKDCGEDLLVEISEVL
FNELAFFKLMQDLDNNSITVKQRCKRKIEATGVIQSCAKEAKRILEDHGSPAGEIDDEDK
DKDETETVKQTQTSEVYDGPKNVRSDISDQEEDEESEGCPVSINLSKAETQALTNYGSGE
DENEDEEMEEFEEGPVDVQTSLQANTEATEENEHDEQVLQRDFKKTAESKNVPLEREATS
KNDQNNCPVKPCYLNILEDEQPLNSAAHKESPPTVDSTQQPNPLPLRLPEMEPLVPRVKE
VKSAQETPESSLAGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVEDLPLKLTIYSEAD
LRKKMVEEEQKNHLSGEICEMQTEELAGNSETLKEPETVGAQSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IN23	0.098	0.099	0.000	2018	0.516	0.518	A0A0R4IN23.pdb.gz
2	AFDB:Q15154	0.999	0.999	0.000	2024	1.000	1.000	Q15154.pdb.gz	PCM1_HUMAN Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5
3	AFDB:Q9R0L6	0.111	0.111	0.000	2025	0.884	0.883	Q9R0L6.pdb.gz	PCM1_MOUSE Pericentriolar material 1 protein OS=Mus musculus OX=10090 GN=Pcm1 PE=1 SV=2
4	AFDB:E7EV93	0.043	0.092	3.532E-69	749	0.350	0.947	E7EV93.pdb.gz	E7EV93_HUMAN Pericentriolar material 1 (Fragment) OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=1
5	AFDB:Q57Y65	0.056	0.063	4.303E-6	1617	0.099	0.124	Q57Y65.pdb.gz	Q57Y65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.280 PE=4 SV=1
6	AFDB:Q6ZU35	0.041	0.057	2.655E-4	1233	0.104	0.170	Q6ZU35.pdb.gz	CRACD_HUMAN Capping protein-inhibiting regulator of actin dynamics OS=Homo sapiens OX=9606 GN=CRACD PE=1 SV=3
7	AFDB:P00522	0.038	0.046	1.069E-3	1620	0.077	0.096	P00522.pdb.gz	ABL_DROME Tyrosine-protein kinase Abl OS=Drosophila melanogaster OX=7227 GN=Abl PE=1 SV=3
8	AFDB:F1QI87	0.037	0.037	1.133E-3	2055	0.131	0.129	F1QI87.pdb.gz	F1QI87_DANRE GON-4-like protein OS=Danio rerio OX=7955 GN=fb99g07 PE=4 SV=1
9	AFDB:E7FF48	0.037	0.033	1.349E-3	2315	0.137	0.120	E7FF48.pdb.gz	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
10	AFDB:Q9DB00	0.034	0.032	2.275E-3	2260	0.140	0.125	Q9DB00.pdb.gz	GON4L_MOUSE GON-4-like protein OS=Mus musculus OX=10090 GN=Gon4l PE=1 SV=3
11	PDB:1y4cA	0.038	0.128	2.743E-1	480	0.007	0.031	1y4cA.pdb.gz	De novo design of an IL-4 antagonist and its structure at 1.9 A.
12	PDB:5mx5L	0.023	0.116	5.196E-1	214	0.011	0.103	5mx5L.pdb.gz
13	PDB:2zdiB	0.041	0.729	5.506E-1	106	0.007	0.132	2zdiB.pdb.gz
14	PDB:6qlfQ	0.039	0.304	6.946E-1	204	0.016	0.157	6qlfQ.pdb.gz
15	PDB:6z6oC	0.038	0.098	7.801E-1	548	0.011	0.042	6z6oC.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
16	PDB:1ddbA	0.040	0.237	8.761E-1	195	0.012	0.123	1ddbA.pdb.gz
17	PDB:3iqcA	0.040	0.368	9.285E-1	119	0.004	0.067	3iqcA.pdb.gz
18	PDB:5nikD	0.035	0.149	9.840E-1	340	0.008	0.050	5nikD.pdb.gz
19	PDB:7o37c	0.039	0.195	1.043	259	0.006	0.046	7o37c.pdb.gz	Structure and assembly of the mammalian mitochondrial supercomplex CIII 2 CIV.
20	PDB:6tz402	0.048	0.408	1.105	176	0.009	0.102	6tz402.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A4W8VX11	0.0	3491	1860	0.875	0.953	A0A4W8VX11_HUMAN Pericentriolar material 1 OS=Homo sapiens OX=9606 GN=PCM1 PE=4 SV=1
2	A0A5H1ZRS1	0.0	4161	2016	0.996	1.000	A0A5H1ZRS1_HUMAN Pericentriolar material 1 OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=1
3	E7EV93	0.0	1439	749	0.350	0.947	E7EV93_HUMAN Pericentriolar material 1 (Fragment) OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=1
4	G3V7E6	0.0	3489	2026	0.885	0.885	G3V7E6_RAT Pericentriolar material 1 OS=Rattus norvegicus OX=10116 GN=Pcm1 PE=1 SV=1
5	H0YBA1	0.0	1515	764	0.368	0.974	H0YBA1_HUMAN Pericentriolar material 1 OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=2
6	Q15154	0.0	4184	2024	1.000	1.000	PCM1_HUMAN Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5
7	Q9PVV4	0.0	2115	2031	0.603	0.601	PCM1_XENLA Pericentriolar material 1 protein OS=Xenopus laevis OX=8355 GN=pcm1 PE=1 SV=1
8	Q9R0L6	0.0	3528	2025	0.886	0.886	PCM1_MOUSE Pericentriolar material 1 protein OS=Mus musculus OX=10090 GN=Pcm1 PE=1 SV=2
9	Q9VDS6	5.2	34.3	324	0.014	0.086	SURF6_DROME Surfeit locus protein 6 homolog OS=Drosophila melanogaster OX=7227 GN=Surf6 PE=1 SV=1
10	F1MNT4	7.7	34.3	1786	0.024	0.027	F1MNT4_BOVIN Laminin subunit beta 1 OS=Bos taurus OX=9913 GN=LAMB1 PE=4 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15717 PCM1_C	6.2e-272	915.5	Pericentriolar material 1 C terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327077

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000268057	0.973	Bardet-Biedl syndrome 4 protein
2	9606.ENSP00000355593	0.971	Disrupted in schizophrenia 1 protein
3	9606.ENSP00000352572	0.928	Pericentrin
4	9606.ENSP00000264935	0.922	Centrosomal protein of 72 kDa
5	9606.ENSP00000393583	0.890	Centrosomal protein of 131 kDa
6	9606.ENSP00000344314	0.889	Oral-facial-digital syndrome 1 protein
7	9606.ENSP00000448012	0.875	Centrosomal protein of 290 kDa
8	9606.ENSP00000371472	0.840	Ninein
9	9606.ENSP00000305699	0.837	Protein Hook homolog 3
10	9606.ENSP00000255759	0.828	LisH domain-containing protein FOPNL
11	9606.ENSP00000317469	0.781	Bardet-Biedl syndrome 1 protein
12	9606.ENSP00000261537	0.774	E3 ubiquitin-protein ligase MIB1
13	9606.ENSP00000334002	0.751	Huntingtin-associated protein 1
14	9606.ENSP00000319052	0.736	Centrin-1
15	9606.ENSP00000354791	0.693	Dynactin subunit 1
16	9606.ENSP00000375872	0.689	Autophagy-related protein 16-1
17	9606.ENSP00000240079	0.683	WASH complex subunit 3
18	9606.ENSP00000433146	0.676	Ubiquitin carboxyl-terminal hydrolase 47
19	9606.ENSP00000316357	0.667	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
20	9606.ENSP00000381577	0.664	Ubiquitin carboxyl-terminal hydrolase 34

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.957	biological regulation
GO:0050789	0.926	regulation of biological process
GO:0050794	0.900	regulation of cellular process
GO:0051179	0.856	localization
GO:0051641	0.853	cellular localization
GO:0033036	0.807	macromolecule localization
GO:0008104	0.803	protein localization
GO:0006996	0.793	organelle organization
GO:0033365	0.707	protein localization to organelle
GO:0007017	0.691	microtubule-based process
GO:0007010	0.684	cytoskeleton organization
GO:1905508	0.609	protein localization to microtubule organizing center
GO:0048518	0.561	positive regulation of biological process
GO:0000226	0.560	microtubule cytoskeleton organization
GO:0048522	0.553	positive regulation of cellular process
GO:0022607	0.541	cellular component assembly
GO:0051234	0.436	establishment of localization
GO:0070925	0.345	organelle assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0016020	0.996	membrane
GO:0012505	0.996	endomembrane system
GO:0034451	0.996	centriolar satellite
GO:0005654	0.996	nucleoplasm
GO:0031090	0.989	organelle membrane
GO:0031975	0.968	envelope
GO:0031967	0.929	organelle envelope
GO:0005635	0.915	nuclear envelope
GO:0031965	0.912	nuclear membrane
GO:0032991	0.737	protein-containing complex
GO:0042995	0.729	cell projection
GO:0005929	0.658	cilium
GO:0071944	0.301	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]