StarFunc result for job id Q15155

User Input

>input (1222 residues)
MLVGQGAGPLGPAVVTAAVVLLLSGVGPAHGSEDIVVGCGGFVKSDVEINYSLIEIKLYT
KHGTLKYQTDCAPNNGYFMIPLYDKGDFILKIEPPLGWSFEPTTVELHVDGVSDICTKGG
DINFVFTGFSVNGKVLSKGQPLGPAGVQVSLRNTGTEAKIQSTVTQPGGKFAFFKVLPGD
YEILATHPTWALKEASTTVRVTNSNANAASPLIVAGYNVSGSVRSDGEPMKGVKFLLFSS
LVTKEDVLGCNVSPVPGFQPQDESLVYLCYTVSREDGSFSFYSLPSGGYTVIPFYRGERI
TFDVAPSRLDFTVEHDSLKIEPVFHVMGFSVTGRVLNGPEGDGVPEAVVTLNNQIKVKTK
ADGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVCGQISIIRFP
DTVKQMNKYKVVLSSQDKDKSLVTVETDAHGSFCFKAKPGTYKVQVMVPEAETRAGLTLK
PQTFPLTVTNRPMMDVAFVQFLASVSGKVSCLDTCGDLLVTLQSLSRQGEKRSLQLSGKV
NAMTFTFDNVLPGKYKISIMHEDWCWKNKSLEVEVLEDDMSAVEFRQTGYMLRCSLSHAI
TLEFYQDGNGRENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQAFYTYDTSSPSILT
LTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRREQQLAEIEARRQE
REKNGNEEGEERMTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTPSSKELLFYPPSME
AVVSGESCPGKLIEIHGKAGLFLEGQIHPELEGVEIVISEKGASSPLITVFTDDKGAYSV
GPLHSDLEYTVTSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPLPGVLLSLSGG
LFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNLKITITGYRTA
YSCYGTVSSLNGEPEQGVAMEAVGQNDCSIYGEDTVTDEEGKFRLRGLLPGCVYHVQLKA
EGNDHIERALPHHRVIEVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYLPTLWVKLYKS
ENLDNPIQTVSLGQSLFFHFPPLLRDGENYVVLLDSTLPRSQYDYILPQVSFTAVGYHKH
ITLIFNPTRKLPEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRALGQA
ASDNSGPEDAKRQAKKQKTRRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5JPE7	0.455	0.440	0.000	1267	0.994	0.959	Q5JPE7.pdb.gz	NOMO2_HUMAN BOS complex subunit NOMO2 OS=Homo sapiens OX=9606 GN=NOMO2 PE=1 SV=1
2	AFDB:X1WEJ6	0.460	0.465	0.000	1208	0.687	0.695	X1WEJ6.pdb.gz	X1WEJ6_DANRE Nodal modulator OS=Danio rerio OX=7955 GN=nomo PE=1 SV=1
3	AFDB:A1Z843	0.364	0.370	5.192E-98	1199	0.293	0.299	A1Z843.pdb.gz	A1Z843_DROME Nodal modulator 3 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1371 PE=1 SV=1
4	AFDB:Q9LZQ4	0.370	0.369	2.186E-88	1227	0.289	0.288	Q9LZQ4.pdb.gz	Q9LZQ4_ARATH Carbohydrate-binding-like fold OS=Arabidopsis thaliana OX=3702 GN=T12C14_60 PE=1 SV=1
5	AFDB:H2KYE0	0.517	0.554	1.933E-87	1123	0.225	0.245	H2KYE0.pdb.gz	NRA4_CAEEL Nicotinic receptor-associated protein 4 OS=Caenorhabditis elegans OX=6239 GN=nra-4 PE=1 SV=1
6	AFDB:A5FB63	0.115	0.095	6.424E-21	1578	0.100	0.077	A5FB63.pdb.gz	CHIA_FLAJ1 Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
7	AFDB:O86488	0.125	0.118	1.850E-19	1315	0.106	0.098	O86488.pdb.gz	SDRD_STAAE Serine-aspartate repeat-containing protein D OS=Staphylococcus aureus (strain Newman) OX=426430 GN=sdrD PE=1 SV=1
8	AFDB:Q8N6C5	0.065	0.062	2.543E-19	1336	0.133	0.122	Q8N6C5.pdb.gz	IGSF1_HUMAN Immunoglobulin superfamily member 1 OS=Homo sapiens OX=9606 GN=IGSF1 PE=1 SV=3
9	AFDB:P11627	0.086	0.085	1.547E-12	1260	0.119	0.116	P11627.pdb.gz	L1CAM_MOUSE Neural cell adhesion molecule L1 OS=Mus musculus OX=10090 GN=L1cam PE=1 SV=1
10	AFDB:Q2EY15	0.050	0.051	1.773E-12	1191	0.106	0.108	Q2EY15.pdb.gz	PRTG_MOUSE Protogenin OS=Mus musculus OX=10090 GN=Prtg PE=2 SV=1
11	PDB:5a42A	0.081	0.071	4.009E-9	1597	0.092	0.070	5a42A.pdb.gz
12	PDB:7q1yA	0.049	0.044	3.883E-8	1374	0.079	0.070	7q1yA.pdb.gz
13	PDB:3rfzB	0.087	0.115	1.264E-7	778	0.076	0.120	3rfzB.pdb.gz
14	PDB:7vonA	0.066	0.059	1.516E-7	1399	0.087	0.076	7vonA.pdb.gz
15	PDB:4lnvA	0.062	0.060	3.593E-7	1276	0.074	0.071	4lnvA.pdb.gz
16	PDB:7nycA	0.050	0.040	1.683E-6	1542	0.086	0.068	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:7lhhC	0.077	0.106	1.761E-6	806	0.083	0.125	7lhhC.pdb.gz
18	PDB:6h03A	0.050	0.050	4.570E-6	1223	0.083	0.083	6h03A.pdb.gz
19	PDB:1e07A	0.044	0.076	6.280E-6	642	0.069	0.131	1e07A.pdb.gz
20	PDB:4ziqA	0.051	0.046	7.531E-6	1450	0.093	0.079	4ziqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z843	0.0	595	1199	0.313	0.319	A1Z843_DROME Nodal modulator 3 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG1371 PE=1 SV=1
2	P69849	0.0	2506	1222	0.995	0.995	NOMO3_HUMAN BOS complex subunit NOMO3 OS=Homo sapiens OX=9606 GN=NOMO3 PE=1 SV=2
3	Q15155	0.0	2516	1222	1.000	1.000	NOMO1_HUMAN BOS complex subunit NOMO1 OS=Homo sapiens OX=9606 GN=NOMO1 PE=1 SV=5
4	Q5JPE7	0.0	2502	1267	0.994	0.959	NOMO2_HUMAN BOS complex subunit NOMO2 OS=Homo sapiens OX=9606 GN=NOMO2 PE=1 SV=1
5	X1WEJ6	0.0	1770	1208	0.688	0.696	X1WEJ6_DANRE Nodal modulator OS=Danio rerio OX=7955 GN=nomo PE=1 SV=1
6	Q9LZQ4	1.92e-148	481	1227	0.275	0.274	Q9LZQ4_ARATH Carbohydrate-binding-like fold OS=Arabidopsis thaliana OX=3702 GN=T12C14_60 PE=1 SV=1
7	H2KYE0	7.32e-102	351	1123	0.241	0.262	NRA4_CAEEL Nicotinic receptor-associated protein 4 OS=Caenorhabditis elegans OX=6239 GN=nra-4 PE=1 SV=1
8	Q95SU3	3.08e-49	180	319	0.083	0.320	Q95SU3_DROME SD07707p OS=Drosophila melanogaster OX=7227 GN=CG1371 PE=2 SV=1
9	A5FB63	1.5	35.8	1578	0.051	0.039	CHIA_FLAJ1 Chitinase ChiA OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / JCM 8514 / NBRC 14942 / NCIMB 11054 / UW101) OX=376686 GN=chiA PE=1 SV=1
10	O86488	3.0	34.7	1315	0.083	0.077	SDRD_STAAE Serine-aspartate repeat-containing protein D OS=Staphylococcus aureus (strain Newman) OX=426430 GN=sdrD PE=1 SV=1
11	A1ZA83	8.3	32.3	245	0.016	0.082	A1ZA83_DROME ER membrane protein complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=EMC7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13715 CarbopepD_reg_2	6.2e-16	69.5	CarboxypepD_reg-like domain
2	PF13620 CarboxypepD_reg	4.9e-43	156.6	Carboxypeptidase regulatory-like domain
3	PF13473 Cupredoxin_1	2.3e+02	13.3	Cupredoxin-like domain
4	PF07210 DUF1416	0.027	25.7	Protein of unknown function (DUF1416)
5	PF11008 DUF2846	0.81	21.1	Protein of unknown function (DUF2846)
6	PF10670 DUF4198	0.069	24.9	Domain of unknown function (DUF4198)
7	PF20598 DUF6795	1.3e-06	40.0	Domain of unknown function (DUF6795)
8	PF09430 EMC7_beta-sandw	1.5e-18	78.4	ER membrane protein complex subunit 7, beta-sandwich domain
9	PF14686 fn3_3	5.5e-07	40.6	Polysaccharide lyase family 4, domain II
10	PF16371 MetallophosN	1.5e+02	14.0	N terminal of Calcineurin-like phosphoesterase
11	PF17210 SdrD_B	5.1e-25	99.3	SdrD B-like domain
12	PF17802 SpaA	6.7e-19	79.0	Prealbumin-like fold domain
13	PF01060 TTR-52	0.33	22.8	Transthyretin-like family
14	PF06427 UDP-g_GGTase	1.9e+02	13.5	UDP-glucose:Glycoprotein Glucosyltransferase
15	PF07495 Y_Y_Y	0.028	25.7	Y_Y_Y domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287667

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000379691	0.867	Pyridoxal-dependent decarboxylase domain-containing protein 1
2	9606.ENSP00000246117	0.785	Nicalin
3	9606.ENSP00000261658	0.764	Bifunctional apoptosis regulator
4	9606.ENSP00000446882	0.505	Nuclear pore complex interacting protein family member A2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043022	1.000	ribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.994	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0009987	0.871	cellular process
GO:0048519	0.695	negative regulation of biological process
GO:0009966	0.675	regulation of signal transduction
GO:0008152	0.598	metabolic process
GO:0071704	0.546	organic substance metabolic process
GO:0044238	0.522	primary metabolic process
GO:0006807	0.504	nitrogen compound metabolic process
GO:0043170	0.471	macromolecule metabolic process
GO:0048523	0.468	negative regulation of cellular process
GO:0009968	0.420	negative regulation of signal transduction
GO:0032925	0.379	regulation of activin receptor signaling pathway
GO:0090101	0.351	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1901564	0.327	organonitrogen compound metabolic process
GO:0051241	0.325	negative regulation of multicellular organismal process
GO:0051093	0.320	negative regulation of developmental process
GO:0071840	0.300	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	0.999	endomembrane system
GO:0043229	0.998	intracellular organelle
GO:0043227	0.997	membrane-bounded organelle
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0005737	0.991	cytoplasm
GO:0032991	0.943	protein-containing complex
GO:0031090	0.927	organelle membrane
GO:0005783	0.926	endoplasmic reticulum
GO:0031984	0.900	organelle subcompartment
GO:0042175	0.835	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0005789	0.833	endoplasmic reticulum membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]