StarFunc result for job id Q15172

User Input

>input (486 residues)
MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET
EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL
SNTSAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15172	1.000	1.000	3.263E-60	486	1.000	1.000	Q15172.pdb.gz	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
2	AFDB:Q6DFL3	0.919	0.938	5.893E-53	476	0.877	0.895	Q6DFL3.pdb.gz	Q6DFL3_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5b.L PE=2 SV=1
3	AFDB:A4FV68	0.901	0.937	8.509E-49	467	0.745	0.775	A4FV68.pdb.gz	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
4	AFDB:Q15173	0.925	0.905	5.060E-48	497	0.689	0.674	Q15173.pdb.gz	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
5	AFDB:Q9VB23	0.901	0.836	7.328E-46	524	0.698	0.647	Q9VB23.pdb.gz	Q9VB23_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wdb PE=1 SV=2
6	AFDB:O18178	0.873	0.785	8.990E-44	542	0.626	0.561	O18178.pdb.gz	2A51_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1 OS=Caenorhabditis elegans OX=6239 GN=pptr-1 PE=1 SV=4
7	AFDB:Q499R1	0.847	0.665	2.754E-43	622	0.626	0.489	Q499R1.pdb.gz	Q499R1_RAT Ppp2r5d protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=2 SV=1
8	AFDB:Q13362	0.831	0.771	1.474E-41	524	0.613	0.569	Q13362.pdb.gz	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
9	AFDB:A0A0B4KHB9	0.851	0.581	5.792E-41	716	0.601	0.408	A0A0B4KHB9.pdb.gz	A0A0B4KHB9_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
10	AFDB:Q8IN89	0.825	0.410	1.124E-40	984	0.586	0.290	Q8IN89.pdb.gz	Q8IN89_DROME Well-rounded, isoform B OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
11	PDB:6ntsB	0.702	0.935	8.923E-37	361	0.737	0.992	6ntsB.pdb.gz	Selective PP2A Enhancement through Biased Heterotrimer Stabilization.
12	PDB:5tbkA	0.308	0.343	2.721E-4	417	0.095	0.110	5tbkA.pdb.gz
13	PDB:1b3uA	0.268	0.234	3.791E-4	588	0.107	0.088	1b3uA.pdb.gz
14	PDB:1wa5B	0.318	0.327	7.996E-4	466	0.113	0.118	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
15	PDB:3tpoA	0.314	0.339	9.438E-4	438	0.088	0.098	3tpoA.pdb.gz
16	PDB:6xu2A	0.403	0.208	1.262E-3	1091	0.111	0.049	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
17	PDB:3w3uA	0.402	0.219	1.832E-3	1030	0.109	0.051	3w3uA.pdb.gz
18	PDB:2xwuB	0.420	0.250	2.661E-3	910	0.091	0.048	2xwuB.pdb.gz
19	PDB:3w3zA	0.447	0.244	3.141E-3	1013	0.123	0.059	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
20	PDB:4f52E	0.241	0.229	3.557E-3	523	0.119	0.111	4f52E.pdb.gz	Structure of a Glomulin-RBX1-CUL1 Complex: Inhibition of a RING E3 Ligase through Masking of Its E2-Binding Surface.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHB9	602	716	0.584	0.397	A0A0B4KHB9_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
2	A0A0B4KHP7	602	683	0.584	0.416	A0A0B4KHP7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
3	A0A8I6A6K6	637	671	0.615	0.446	A0A8I6A6K6_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=1
4	A4FV68	717	467	0.745	0.775	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
5	A9UJN4	574	607	0.558	0.446	A9UJN4_CAEEL Serine/threonine protein phosphatase 2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=pptr-2 PE=1 SV=1
6	B7Z0L6	601	703	0.584	0.404	B7Z0L6_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
7	B7Z0L7	540	438	0.516	0.573	B7Z0L7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
8	F1MAA3	632	592	0.613	0.503	F1MAA3_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=3
9	O18178	647	542	0.646	0.579	2A51_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1 OS=Caenorhabditis elegans OX=6239 GN=pptr-1 PE=1 SV=4
10	Q0KI58	602	670	0.584	0.424	Q0KI58_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
11	Q13362	612	524	0.619	0.574	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
12	Q14738	637	602	0.615	0.497	2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1
13	Q15172	998	486	1.000	1.000	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
14	Q15173	687	497	0.685	0.670	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
15	Q16537	717	467	0.745	0.775	2A5E_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E PE=1 SV=1
16	Q499R1	638	622	0.615	0.481	Q499R1_RAT Ppp2r5d protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=2 SV=1
17	Q5BIJ2	601	656	0.584	0.433	Q5BIJ2_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
18	Q5XH34	713	467	0.747	0.777	Q5XH34_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5e.S PE=1 SV=1
19	Q60996	610	524	0.619	0.574	2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Mus musculus OX=10090 GN=Ppp2r5c PE=1 SV=2
20	Q61151	716	467	0.743	0.773	2A5E_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Mus musculus OX=10090 GN=Ppp2r5e PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01603 B56	2.4e-179	608.3	Protein phosphatase 2A regulatory B subunit (B56 family)
2	PF12783 Sec7_N	1.1e+02	14.2	Guanine nucleotide exchange factor in Golgi transport N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000003456

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007292	0.999	Protein phosphatase 2, regulatory subunit A, alpha
2	61853.ENSNLEP00000009847	0.999	Protein phosphatase 2, catalytic subunit, alpha isozyme
3	61853.ENSNLEP00000008867	0.998	Protein phosphatase 2, regulatory subunit A, beta
4	61853.ENSNLEP00000014569	0.995	Protein phosphatase 2, catalytic subunit, beta isozyme
5	61853.ENSNLEP00000005574	0.967	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
6	61853.ENSNLEP00000019652	0.966	Protein phosphatase 2, regulatory subunit B, alpha
7	61853.ENSNLEP00000021415	0.934	Serine/threonine-protein phosphatase 2A activator
8	61853.ENSNLEP00000004271	0.924	Shugoshin-like 1 (S. pombe)
9	61853.ENSNLEP00000020963	0.924	Protein phosphatase 4, regulatory subunit 4
10	61853.ENSNLEP00000019153	0.921	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit
11	61853.ENSNLEP00000019838	0.917	V-akt murine thymoma viral oncogene homolog 1
12	61853.ENSNLEP00000007753	0.913	Protein phosphatase 1, catalytic subunit, alpha isozyme
13	61853.ENSNLEP00000001898	0.911	Protein phosphatase 2, regulatory subunit B, delta
14	61853.ENSNLEP00000003868	0.910	Protein phosphatase 1, catalytic subunit, gamma isozyme
15	61853.ENSNLEP00000004803	0.910	V-akt murine thymoma viral oncogene homolog 3
16	61853.ENSNLEP00000006189	0.910	Protein phosphatase 1, regulatory subunit 12A
17	61853.ENSNLEP00000020260	0.906	Protein phosphatase 3, catalytic subunit, beta isozyme
18	61853.ENSNLEP00000024305	0.906	Protein phosphatase 3, catalytic subunit, alpha isozyme
19	61853.ENSNLEP00000018622	0.903	Protein phosphatase 1, catalytic subunit, beta isozyme
20	61853.ENSNLEP00000012174	0.879	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030234	0.871	enzyme regulator activity
GO:0019888	0.815	protein phosphatase regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0008152	0.965	metabolic process
GO:0071704	0.963	organic substance metabolic process
GO:0060255	0.943	regulation of macromolecule metabolic process
GO:0048522	0.925	positive regulation of cellular process
GO:0080090	0.921	regulation of primary metabolic process
GO:0051171	0.915	regulation of nitrogen compound metabolic process
GO:0048519	0.900	negative regulation of biological process
GO:0031323	0.860	regulation of cellular metabolic process
GO:0006807	0.834	nitrogen compound metabolic process
GO:0043170	0.796	macromolecule metabolic process
GO:0051246	0.788	regulation of protein metabolic process
GO:0009893	0.774	positive regulation of metabolic process
GO:0044238	0.767	primary metabolic process
GO:0019220	0.759	regulation of phosphate metabolic process
GO:0044237	0.745	cellular metabolic process
GO:0048523	0.727	negative regulation of cellular process
GO:0031325	0.655	positive regulation of cellular metabolic process
GO:0031399	0.652	regulation of protein modification process
GO:0050896	0.615	response to stimulus
GO:1901564	0.612	organonitrogen compound metabolic process
GO:0019538	0.603	protein metabolic process
GO:0010604	0.541	positive regulation of macromolecule metabolic process
GO:0007154	0.539	cell communication
GO:0051173	0.535	positive regulation of nitrogen compound metabolic process
GO:0023052	0.532	signaling
GO:0035303	0.484	regulation of dephosphorylation
GO:0051716	0.479	cellular response to stimulus
GO:0045937	0.464	positive regulation of phosphate metabolic process
GO:0065009	0.463	regulation of molecular function
GO:0048583	0.459	regulation of response to stimulus
GO:0036211	0.455	protein modification process
GO:0007165	0.443	signal transduction
GO:0009966	0.437	regulation of signal transduction
GO:0051247	0.376	positive regulation of protein metabolic process
GO:0071840	0.364	cellular component organization or biogenesis
GO:0016043	0.338	cellular component organization
GO:0042325	0.337	regulation of phosphorylation
GO:0031401	0.327	positive regulation of protein modification process
GO:0009892	0.320	negative regulation of metabolic process
GO:0050790	0.308	regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0005829	0.957	cytosol
GO:0032991	0.897	protein-containing complex
GO:0070013	0.864	intracellular organelle lumen
GO:0043231	0.859	intracellular membrane-bounded organelle
GO:0005634	0.828	nucleus
GO:0016020	0.818	membrane
GO:1902494	0.658	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]