StarFunc result for job id Q15173

User Input

>input (497 residues)
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFL
RFIYEFEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKE
APLQRLTPQVAASGGQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15173	1.000	1.000	4.913E-62	497	1.000	1.000	Q15173.pdb.gz	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
2	AFDB:Q15172	0.907	0.927	1.458E-47	486	0.674	0.689	Q15172.pdb.gz	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
3	AFDB:A4FV68	0.892	0.947	5.594E-47	467	0.676	0.719	A4FV68.pdb.gz	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
4	AFDB:Q6DFL3	0.872	0.910	8.407E-47	476	0.676	0.706	Q6DFL3.pdb.gz	Q6DFL3_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5b.L PE=2 SV=1
5	AFDB:Q9VB23	0.900	0.854	2.849E-44	524	0.646	0.613	Q9VB23.pdb.gz	Q9VB23_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wdb PE=1 SV=2
6	AFDB:Q499R1	0.848	0.681	1.577E-43	622	0.628	0.502	Q499R1.pdb.gz	Q499R1_RAT Ppp2r5d protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=2 SV=1
7	AFDB:O18178	0.853	0.783	3.086E-42	542	0.616	0.565	O18178.pdb.gz	2A51_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1 OS=Caenorhabditis elegans OX=6239 GN=pptr-1 PE=1 SV=4
8	AFDB:A0A0B4KHB9	0.848	0.592	3.414E-41	716	0.590	0.409	A0A0B4KHB9.pdb.gz	A0A0B4KHB9_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
9	AFDB:Q13362	0.834	0.791	1.112E-40	524	0.592	0.561	Q13362.pdb.gz	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
10	AFDB:Q8IN89	0.816	0.414	1.159E-40	984	0.586	0.296	Q8IN89.pdb.gz	Q8IN89_DROME Well-rounded, isoform B OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
11	PDB:6ntsB	0.689	0.939	9.107E-33	361	0.555	0.765	6ntsB.pdb.gz	Selective PP2A Enhancement through Biased Heterotrimer Stabilization.
12	PDB:5tbkA	0.318	0.362	2.783E-4	417	0.105	0.125	5tbkA.pdb.gz
13	PDB:6xu2A	0.386	0.206	7.397E-4	1091	0.105	0.048	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
14	PDB:1b3uA	0.275	0.243	1.206E-3	588	0.109	0.092	1b3uA.pdb.gz
15	PDB:3tpoA	0.290	0.316	1.888E-3	438	0.103	0.116	3tpoA.pdb.gz
16	PDB:3zkvA	0.363	0.233	2.222E-3	873	0.107	0.061	3zkvA.pdb.gz
17	PDB:3w3zA	0.430	0.239	2.511E-3	1013	0.129	0.063	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
18	PDB:2xwuB	0.394	0.246	2.724E-3	910	0.078	0.043	2xwuB.pdb.gz
19	PDB:3w3uA	0.434	0.239	2.955E-3	1030	0.135	0.065	3w3uA.pdb.gz
20	PDB:7rroH7	0.281	0.249	3.206E-3	580	0.095	0.081	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KHB9	582	716	0.561	0.390	A0A0B4KHB9_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
2	A0A0B4KHP7	583	683	0.561	0.408	A0A0B4KHP7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
3	A0A8I6A6K6	619	671	0.604	0.447	A0A8I6A6K6_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=1
4	A4FV68	677	467	0.678	0.722	2A5E_BOVIN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Bos taurus OX=9913 GN=PPP2R5E PE=1 SV=1
5	A9UJN4	561	607	0.559	0.458	A9UJN4_CAEEL Serine/threonine protein phosphatase 2A regulatory subunit OS=Caenorhabditis elegans OX=6239 GN=pptr-2 PE=1 SV=1
6	B7Z0L6	582	703	0.561	0.397	B7Z0L6_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
7	B7Z0L7	529	438	0.497	0.564	B7Z0L7_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
8	F1MAA3	612	592	0.600	0.503	F1MAA3_RAT Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=1 SV=3
9	O18178	622	542	0.592	0.542	2A51_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit pptr-1 OS=Caenorhabditis elegans OX=6239 GN=pptr-1 PE=1 SV=4
10	Q0KI58	582	670	0.561	0.416	Q0KI58_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
11	Q13362	585	524	0.575	0.546	2A5G_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Homo sapiens OX=9606 GN=PPP2R5C PE=1 SV=3
12	Q14738	619	602	0.604	0.498	2A5D_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1
13	Q15172	692	486	0.644	0.658	2A5A_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R5A PE=1 SV=1
14	Q15173	1019	497	1.000	1.000	2A5B_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform OS=Homo sapiens OX=9606 GN=PPP2R5B PE=1 SV=1
15	Q16537	677	467	0.678	0.722	2A5E_HUMAN Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Homo sapiens OX=9606 GN=PPP2R5E PE=1 SV=1
16	Q499R1	620	622	0.604	0.482	Q499R1_RAT Ppp2r5d protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ppp2r5d PE=2 SV=1
17	Q5BIJ2	582	656	0.561	0.425	Q5BIJ2_DROME Serine/threonine protein phosphatase 2A regulatory subunit OS=Drosophila melanogaster OX=7227 GN=wrd PE=1 SV=1
18	Q5XH34	678	467	0.684	0.728	Q5XH34_XENLA Serine/threonine protein phosphatase 2A regulatory subunit OS=Xenopus laevis OX=8355 GN=ppp2r5e.S PE=1 SV=1
19	Q60996	584	524	0.584	0.553	2A5G_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform OS=Mus musculus OX=10090 GN=Ppp2r5c PE=1 SV=2
20	Q61151	676	467	0.678	0.722	2A5E_MOUSE Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform OS=Mus musculus OX=10090 GN=Ppp2r5e PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01603 B56	3.1e-173	588.1	Protein phosphatase 2A regulatory B subunit (B56 family)
2	PF04961 FTCD_C	2.7e+02	12.7	Formiminotransferase-cyclodeaminase
3	PF03288 Pox_D5	3.9e+02	12.9	Poxvirus D5 protein-like
4	PF12783 Sec7_N	3.8e+02	12.4	Guanine nucleotide exchange factor in Golgi transport N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000164133

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324804	0.999	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
2	9606.ENSP00000418447	0.999	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
3	9606.ENSP00000451828	0.978	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000311344	0.974	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
5	9606.ENSP00000221138	0.960	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
6	9606.ENSP00000375892	0.945	RAC-beta serine/threonine-protein kinase
7	9606.ENSP00000263826	0.944	RAC-gamma serine/threonine-protein kinase
8	9606.ENSP00000381958	0.944	Kinase suppressor of Ras 1
9	9606.ENSP00000284523	0.940	Protein Wnt-3a
10	9606.ENSP00000377036	0.938	Serine/threonine-protein phosphatase 2A activator
11	9606.ENSP00000362680	0.918	Proto-oncogene tyrosine-protein kinase Src
12	9606.ENSP00000411397	0.918	MAP/microtubule affinity-regulating kinase 3
13	9606.ENSP00000325074	0.917	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform
14	9606.ENSP00000407586	0.915	GTPase HRas
15	9606.ENSP00000368169	0.914	Segment polarity protein dishevelled homolog DVL-1
16	9606.ENSP00000303830	0.912	Insulin receptor
17	9606.ENSP00000256078	0.911	GTPase KRas
18	9606.ENSP00000346671	0.911	Tyrosine-protein kinase Fyn
19	9606.ENSP00000462468	0.911	Tyrosine-protein kinase Yes
20	9606.ENSP00000251849	0.910	RAF proto-oncogene serine/threonine-protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019208	1.000	phosphatase regulator activity
GO:0019888	0.992	protein phosphatase regulator activity
GO:0003824	0.729	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0019222	0.994	regulation of metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0009987	0.968	cellular process
GO:0080090	0.965	regulation of primary metabolic process
GO:0031323	0.965	regulation of cellular metabolic process
GO:0051171	0.962	regulation of nitrogen compound metabolic process
GO:0048519	0.947	negative regulation of biological process
GO:0048518	0.879	positive regulation of biological process
GO:0048523	0.843	negative regulation of cellular process
GO:0051246	0.842	regulation of protein metabolic process
GO:0050896	0.815	response to stimulus
GO:0019219	0.812	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.794	regulation of gene expression
GO:0031326	0.794	regulation of cellular biosynthetic process
GO:0009893	0.785	positive regulation of metabolic process
GO:0042325	0.769	regulation of phosphorylation
GO:0048522	0.759	positive regulation of cellular process
GO:0010604	0.749	positive regulation of macromolecule metabolic process
GO:0031399	0.733	regulation of protein modification process
GO:0051252	0.727	regulation of RNA metabolic process
GO:0051173	0.723	positive regulation of nitrogen compound metabolic process
GO:0031325	0.702	positive regulation of cellular metabolic process
GO:0010556	0.688	regulation of macromolecule biosynthetic process
GO:0065009	0.670	regulation of molecular function
GO:0048583	0.644	regulation of response to stimulus
GO:0008152	0.620	metabolic process
GO:2001141	0.561	regulation of RNA biosynthetic process
GO:0007154	0.552	cell communication
GO:0001932	0.521	regulation of protein phosphorylation
GO:0023052	0.516	signaling
GO:0044237	0.506	cellular metabolic process
GO:0071704	0.487	organic substance metabolic process
GO:0023051	0.484	regulation of signaling
GO:0010646	0.484	regulation of cell communication
GO:0051716	0.470	cellular response to stimulus
GO:0007165	0.459	signal transduction
GO:0009966	0.447	regulation of signal transduction
GO:0044238	0.438	primary metabolic process
GO:0006355	0.431	regulation of DNA-templated transcription
GO:0006807	0.424	nitrogen compound metabolic process
GO:1901564	0.383	organonitrogen compound metabolic process
GO:0051247	0.364	positive regulation of protein metabolic process
GO:0043170	0.343	macromolecule metabolic process
GO:0051726	0.320	regulation of cell cycle
GO:0019538	0.310	protein metabolic process
GO:0043412	0.301	macromolecule modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043229	0.945	intracellular organelle
GO:0043231	0.928	intracellular membrane-bounded organelle
GO:0005634	0.648	nucleus
GO:0043233	0.520	organelle lumen
GO:0070013	0.507	intracellular organelle lumen
GO:0005886	0.489	plasma membrane
GO:0043228	0.346	non-membrane-bounded organelle
GO:0043232	0.339	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]