StarFunc result for job id Q15181

User Input

>input (289 residues)
MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEI
ATKDPLNPIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPI
DVCEIGSKVCARGEIIGVKVLGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKP
GYLEATVDWFRRYKVPDGKPENEFAFNAEFKDKDFAIDIIKSTHDHWKALVTKKTNGKGI
SCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15181	1.000	1.000	6.468E-66	289	1.000	1.000	Q15181.pdb.gz	IPYR_HUMAN Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2
2	PDB:6c45A	0.976	0.986	1.146E-58	286	0.986	0.997	6c45A.pdb.gz
3	AFDB:Q91VM9	0.967	0.849	1.285E-49	330	0.602	0.527	Q91VM9.pdb.gz	IPYR2_MOUSE Inorganic pyrophosphatase 2, mitochondrial OS=Mus musculus OX=10090 GN=Ppa2 PE=1 SV=1
4	AFDB:Q9H2U2	0.963	0.835	2.436E-48	334	0.619	0.536	Q9H2U2.pdb.gz	IPYR2_HUMAN Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2
5	AFDB:O77460	0.966	0.828	5.980E-45	338	0.536	0.459	O77460.pdb.gz	IPYR_DROME Inorganic pyrophosphatase OS=Drosophila melanogaster OX=7227 GN=Nurf-38 PE=1 SV=3
6	AFDB:P00817	0.936	0.943	4.000E-43	287	0.526	0.530	P00817.pdb.gz	IPYR_YEAST Inorganic pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IPP1 PE=1 SV=4
7	AFDB:Q18680	0.950	0.645	5.735E-43	427	0.512	0.347	Q18680.pdb.gz	IPYR_CAEEL Inorganic pyrophosphatase 1 OS=Caenorhabditis elegans OX=6239 GN=pyp-1 PE=1 SV=5
8	AFDB:Q6FRB7	0.945	0.952	7.744E-43	287	0.509	0.512	Q6FRB7.pdb.gz	IPYR_CANGA Inorganic pyrophosphatase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IPP1 PE=3 SV=1
9	AFDB:P83777	0.944	0.947	1.179E-42	288	0.512	0.514	P83777.pdb.gz	IPYR_CANAL Inorganic pyrophosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IPP1 PE=1 SV=3
10	PDB:2ik0B	0.938	0.948	1.326E-42	286	0.519	0.524	2ik0B.pdb.gz	A Complete Structural Description of the Catalytic Cycle of Yeast Pyrophosphatase.
11	AFDB:Q5B912	0.942	0.949	2.732E-42	287	0.498	0.502	Q5B912.pdb.gz	IPYR_EMENI Inorganic pyrophosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ipp1 PE=1 SV=2
12	AFDB:P19117	0.949	0.949	1.866E-41	289	0.478	0.478	P19117.pdb.gz	IPYR_SCHPO Inorganic pyrophosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppa1 PE=3 SV=2
13	PDB:5cuyD	0.738	0.545	3.632E-27	396	0.339	0.247	5cuyD.pdb.gz	Crystal structure of Trypanosoma cruzi protein in complex with ligand
14	PDB:4z71B	0.465	0.790	8.824E-12	163	0.156	0.276	4z71B.pdb.gz	Structural and computational dissection of the catalytic mechanism of the inorganic pyrophosphatase from Mycobacterium tuberculosis.
15	PDB:2au6A	0.515	0.824	5.235E-10	175	0.145	0.240	2au6A.pdb.gz	Reversible inhibition of Escherichia coli inorganic pyrophosphatase by fluoride: trapped catalytic intermediates in cryo-crystallographic studies
16	PDB:4xelA	0.496	0.798	7.068E-10	172	0.163	0.273	4xelA.pdb.gz
17	PDB:6hv96	0.137	0.079	2.849E-1	571	0.083	0.042	6hv96.pdb.gz	Structure of DNA-CMG-Pol epsilon elucidates the roles of the non-catalytic polymerase modules in the eukaryotic replisome.
18	PDB:7pfo4	0.160	0.083	4.338E-1	619	0.066	0.031	7pfo4.pdb.gz	Structure of a human replisome shows the organisation and interactions of a DNA replication machine.
19	PDB:1pwwA	0.129	0.058	4.891E-1	726	0.066	0.026	1pwwA.pdb.gz	The structural basis for substrate and inhibitor selectivity of the anthrax lethal factor.
20	PDB:6raz2	0.154	0.091	4.891E-1	559	0.118	0.061	6raz2.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15181	0.0	599	289	1.000	1.000	IPYR_HUMAN Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2
2	Q9D819	0.0	573	289	0.941	0.941	IPYR_MOUSE Inorganic pyrophosphatase OS=Mus musculus OX=10090 GN=Ppa1 PE=1 SV=1
3	Q9H2U2	8.32e-134	384	334	0.609	0.527	IPYR2_HUMAN Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2
4	Q91VM9	2.12e-130	375	330	0.599	0.524	IPYR2_MOUSE Inorganic pyrophosphatase 2, mitochondrial OS=Mus musculus OX=10090 GN=Ppa2 PE=1 SV=1
5	O77460	9.27e-107	315	338	0.554	0.473	IPYR_DROME Inorganic pyrophosphatase OS=Drosophila melanogaster OX=7227 GN=Nurf-38 PE=1 SV=3
6	Q18680	8.12e-105	313	427	0.529	0.358	IPYR_CAEEL Inorganic pyrophosphatase 1 OS=Caenorhabditis elegans OX=6239 GN=pyp-1 PE=1 SV=5
7	P00817	1.96e-103	305	287	0.522	0.526	IPYR_YEAST Inorganic pyrophosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IPP1 PE=1 SV=4
8	P83777	3.85e-98	291	288	0.516	0.517	IPYR_CANAL Inorganic pyrophosphatase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=IPP1 PE=1 SV=3
9	Q6FRB7	4.58e-98	291	287	0.484	0.488	IPYR_CANGA Inorganic pyrophosphatase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=IPP1 PE=3 SV=1
10	Q5B912	4.48e-97	289	287	0.509	0.512	IPYR_EMENI Inorganic pyrophosphatase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ipp1 PE=1 SV=2
11	P19117	2.65e-92	276	289	0.488	0.488	IPYR_SCHPO Inorganic pyrophosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppa1 PE=3 SV=2
12	P87118	1.52e-82	252	286	0.422	0.427	IPYR2_SCHPO Putative inorganic pyrophosphatase C3A12.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3A12.02 PE=3 SV=1
13	Q93Y52	2.05e-78	241	280	0.401	0.414	IPYR1_CHLRE Soluble inorganic pyrophosphatase 1, chloroplastic OS=Chlamydomonas reinhardtii OX=3055 GN=ppa1 PE=1 SV=1
14	Q54PV8	8.63e-77	237	279	0.419	0.434	IPYR_DICDI Inorganic pyrophosphatase OS=Dictyostelium discoideum OX=44689 GN=ppa1 PE=1 SV=1
15	P28239	1.30e-76	237	310	0.426	0.397	IPYR2_YEAST Inorganic pyrophosphatase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PPA2 PE=1 SV=1
16	Q9LXC9	1.93e-75	234	300	0.405	0.390	IPYR6_ARATH Soluble inorganic pyrophosphatase 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPA6 PE=1 SV=1
17	Q384W3	4.52e-57	190	414	0.349	0.244	Q384W3_TRYB2 inorganic diphosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4930 PE=1 SV=1
18	Q384W5	1.17e-56	189	414	0.346	0.242	Q384W5_TRYB2 inorganic diphosphatase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4910 PE=1 SV=1
19	Q7Z029	3.43e-56	188	414	0.339	0.237	Q7Z029_9TRYP inorganic diphosphatase OS=Trypanosoma brucei OX=5691 PE=3 SV=1
20	Q93V56	1.39e-18	84.0	212	0.232	0.316	IPYR1_ARATH Soluble inorganic pyrophosphatase 1 OS=Arabidopsis thaliana OX=3702 GN=PPA1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00719 Pyrophosphatase	4.3e-56	200.6	Inorganic pyrophosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362329

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000218548	0.966	Potassium-transporting ATPase alpha chain 2
2	9606.ENSP00000262623	0.966	Potassium-transporting ATPase alpha chain 1
3	9606.ENSP00000307208	0.959	Nucleosome-remodeling factor subunit BPTF
4	9606.ENSP00000357835	0.911	Phospholysine phosphohistidine inorganic pyrophosphate phosphatase
5	9606.ENSP00000334216	0.905	Potassium-transporting ATPase subunit beta
6	9606.ENSP00000379156	0.903	Myosin phosphatase Rho-interacting protein
7	9606.ENSP00000389649	0.870	ATP synthase-coupling factor 6, mitochondrial
8	9606.ENSP00000381736	0.840	ATP synthase subunit alpha, mitochondrial
9	9606.ENSP00000434729	0.827	V-type proton ATPase 21 kDa proteolipid subunit
10	9606.ENSP00000349142	0.826	ATP synthase subunit gamma, mitochondrial
11	9606.ENSP00000343885	0.813	Inorganic pyrophosphatase 2, mitochondrial
12	9606.ENSP00000329757	0.793	V-type proton ATPase 16 kDa proteolipid subunit
13	9606.ENSP00000284727	0.781	ATP synthase F(0) complex subunit C3, mitochondrial
14	9606.ENSP00000262030	0.771	ATP synthase subunit beta, mitochondrial
15	9606.ENSP00000290299	0.767	ATP synthase subunit O, mitochondrial
16	9606.ENSP00000358737	0.766	ATP synthase F(0) complex subunit B1, mitochondrial
17	9606.ENSP00000381234	0.765	annotation not available
18	9606.ENSP00000377878	0.762	ATP synthase F(0) complex subunit C2, mitochondrial
19	9606.ENSP00000301587	0.757	ATP synthase subunit d, mitochondrial
20	9606.ENSP00000379203	0.756	V-type proton ATPase subunit C 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004427	1.000	inorganic diphosphate phosphatase activity
GO:0005488	0.934	binding
GO:0005515	0.771	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0006793	0.989	phosphorus metabolic process
GO:0006796	0.881	phosphate-containing compound metabolic process
GO:0071704	0.352	organic substance metabolic process
GO:0065007	0.316	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	0.995	cytosol
GO:0005576	0.966	extracellular region
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0031982	0.941	vesicle
GO:0005615	0.938	extracellular space
GO:0070062	0.931	extracellular exosome
GO:0070013	0.681	intracellular organelle lumen
GO:0005634	0.496	nucleus
GO:0016020	0.468	membrane
GO:0032991	0.346	protein-containing complex
GO:0012505	0.345	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:24576	1.000	diphosphate + H2O = H(+) + 2 phosphate
EC:3.6.1.1	1.000	inorganic diphosphatase.

[back to server]