StarFunc result for job id Q15185

User Input

>input (160 residues)
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCID
PNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNNWKDWEDDSDEDMSNF
DRFSEMMNNMGGDEDVDLPEVDGADDDSQDSDDEKMPDLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G1TGF1	0.772	0.772	2.741E-28	160	1.000	1.000	G1TGF1.pdb.gz	TEBP_RABIT Prostaglandin E synthase 3 OS=Oryctolagus cuniculus OX=9986 GN=PTGES3 PE=3 SV=1
2	PDB:7krjC	0.693	0.831	5.641E-23	133	0.831	1.000	7krjC.pdb.gz	Structure of Hsp90-p23-GR reveals the Hsp90 client-remodelling mechanism.
3	AFDB:Q23280	0.646	0.594	1.876E-11	175	0.325	0.297	Q23280.pdb.gz	DAF41_CAEEL Co-chaperone protein daf-41 OS=Caenorhabditis elegans OX=6239 GN=daf-41 PE=2 SV=1
4	AFDB:Q9FR62	0.649	0.586	1.876E-11	178	0.319	0.287	Q9FR62.pdb.gz	P23A_BRANA Co-chaperone protein p23-1 OS=Brassica napus OX=3708 GN=P23-1 PE=1 SV=1
5	AFDB:Q38BY3	0.629	0.528	2.889E-11	192	0.300	0.250	Q38BY3.pdb.gz	Q38BY3_TRYB2 CS domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5050 PE=3 SV=1
6	AFDB:Q9VH95	0.655	0.574	3.586E-11	184	0.244	0.212	Q9VH95.pdb.gz	YC17_DROME Uncharacterized protein CG16817 OS=Drosophila melanogaster OX=7227 GN=CG16817 PE=1 SV=1
7	AFDB:Q38DY5	0.623	0.594	4.957E-11	168	0.325	0.310	Q38DY5.pdb.gz	Q38DY5_TRYB2 CS domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1690 PE=3 SV=1
8	AFDB:Q8L7U4	0.641	0.432	5.829E-11	241	0.256	0.170	Q8L7U4.pdb.gz	P23A_ARATH Co-chaperone protein p23-1 OS=Arabidopsis thaliana OX=3702 GN=P23-1 PE=1 SV=1
9	AFDB:Q11118	0.636	0.551	8.059E-11	186	0.300	0.258	Q11118.pdb.gz	WOS2_SCHPO Protein wos2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wos2 PE=2 SV=1
10	AFDB:P28707	0.650	0.488	8.506E-11	216	0.306	0.227	P28707.pdb.gz	SBA1_YEAST Co-chaperone protein SBA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SBA1 PE=1 SV=3
11	AFDB:Q6FM25	0.674	0.507	6.270E-10	218	0.275	0.202	Q6FM25.pdb.gz	Q6FM25_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K11572g PE=3 SV=1
12	PDB:2kmwA	0.591	0.627	7.104E-8	150	0.225	0.240	2kmwA.pdb.gz
13	PDB:3w1zB	0.455	0.505	1.690E-4	143	0.113	0.126	3w1zB.pdb.gz
14	PDB:1gmeA	0.442	0.468	3.120E-3	150	0.087	0.093	1gmeA.pdb.gz
15	PDB:1shsA	0.405	0.550	5.071E-3	115	0.050	0.070	1shsA.pdb.gz
16	PDB:7oa6B	0.403	0.422	6.294E-3	152	0.081	0.086	7oa6B.pdb.gz	Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.
17	PDB:4ylbA	0.427	0.524	7.811E-3	128	0.050	0.062	4ylbA.pdb.gz
18	PDB:6f2rA	0.334	0.399	2.704E-2	130	0.075	0.092	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
19	PDB:4zjaA	0.341	0.486	2.854E-2	106	0.062	0.094	4zjaA.pdb.gz
20	PDB:4ydzA	0.383	0.446	4.639E-2	135	0.075	0.089	4ydzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G1TGF1	1.13e-115	325	160	1.000	1.000	TEBP_RABIT Prostaglandin E synthase 3 OS=Oryctolagus cuniculus OX=9986 GN=PTGES3 PE=3 SV=1
2	Q15185	1.13e-115	325	160	1.000	1.000	TEBP_HUMAN Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3 PE=1 SV=1
3	P83868	4.05e-114	322	160	0.988	0.988	TEBP_RAT Prostaglandin E synthase 3 OS=Rattus norvegicus OX=10116 GN=Ptges3 PE=1 SV=2
4	Q9R0Q7	4.05e-114	322	160	0.988	0.988	TEBP_MOUSE Prostaglandin E synthase 3 OS=Mus musculus OX=10090 GN=Ptges3 PE=1 SV=1
5	Q90955	3.30e-92	266	146	0.875	0.959	TEBP_CHICK Prostaglandin E synthase 3 (Fragment) OS=Gallus gallus OX=9031 GN=PTGES3 PE=1 SV=1
6	Q11118	6.24e-14	67.8	186	0.281	0.242	WOS2_SCHPO Protein wos2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wos2 PE=2 SV=1
7	Q38DY5	1.10e-12	64.3	168	0.275	0.262	Q38DY5_TRYB2 CS domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1690 PE=3 SV=1
8	Q9FR62	2.94e-12	63.2	178	0.250	0.225	P23A_BRANA Co-chaperone protein p23-1 OS=Brassica napus OX=3708 GN=P23-1 PE=1 SV=1
9	Q9VH95	1.66e-11	61.2	184	0.225	0.196	YC17_DROME Uncharacterized protein CG16817 OS=Drosophila melanogaster OX=7227 GN=CG16817 PE=1 SV=1
10	Q23280	3.14e-10	57.8	175	0.200	0.183	DAF41_CAEEL Co-chaperone protein daf-41 OS=Caenorhabditis elegans OX=6239 GN=daf-41 PE=2 SV=1
11	P28707	1.84e-08	53.5	216	0.212	0.157	SBA1_YEAST Co-chaperone protein SBA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SBA1 PE=1 SV=3
12	Q8L7U4	1.05e-07	51.6	241	0.181	0.120	P23A_ARATH Co-chaperone protein p23-1 OS=Arabidopsis thaliana OX=3702 GN=P23-1 PE=1 SV=1
13	Q38BY3	4.44e-07	49.7	192	0.269	0.224	Q38BY3_TRYB2 CS domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5050 PE=3 SV=1
14	Q6FM25	1.05e-04	43.1	218	0.175	0.128	Q6FM25_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K11572g PE=3 SV=1
15	Q6ID70	0.006	37.4	150	0.194	0.207	P23B_ARATH Co-chaperone protein p23-2 OS=Arabidopsis thaliana OX=3702 GN=P23-2 PE=1 SV=1
16	F4J2B8	0.019	36.6	204	0.294	0.230	F4J2B8_ARATH Co-chaperone protein p23 OS=Arabidopsis thaliana OX=3702 GN=P23-2 PE=1 SV=1
17	Q9CWU0	0.19	34.3	1215	0.219	0.029	TDR12_MOUSE Putative ATP-dependent RNA helicase TDRD12 OS=Mus musculus OX=10090 GN=Tdrd12 PE=1 SV=2
18	Q9P035	0.35	33.1	362	0.188	0.083	HACD3_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 3 OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=2
19	Q8GYB1	0.70	32.0	285	0.181	0.102	NUD15_ARATH Nudix hydrolase 15, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=NUDT15 PE=1 SV=2
20	H3BPZ1	0.76	32.0	337	0.144	0.068	H3BPZ1_HUMAN Very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase OS=Homo sapiens OX=9606 GN=HACD3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04969 CS	1.6e-06	40.4	CS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000042044

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000021669	0.998	Stress-induced phosphoprotein 1
2	9612.ENSCAFP00000002914	0.995	Heat shock protein 90kDa alpha (cytosolic), class B member 1
3	9612.ENSCAFP00000030067	0.995	Prostaglandin G/H synthase 1
4	9612.ENSCAFP00000038440	0.992	Canis lupus familiaris prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase) (PTGS2), mRNA
5	9612.ENSCAFP00000026650	0.991	annotation not available
6	9612.ENSCAFP00000029770	0.969	Canis lupus familiaris prostaglandin E synthase 2 (PTGES2), mRNA
7	9612.ENSCAFP00000000900	0.957	Belongs to the heat shock protein 70 family.
8	9612.ENSCAFP00000000901	0.957	Uncharacterized protein
9	9612.ENSCAFP00000000903	0.957	Heat shock 70 kDa protein 1
10	9612.ENSCAFP00000017166	0.957	Uncharacterized protein
11	9612.ENSCAFP00000023616	0.957	Belongs to the heat shock protein 70 family.
12	9612.ENSCAFP00000040771	0.956	Prostaglandin E synthase
13	9612.ENSCAFP00000012766	0.955	Peptidylprolyl isomerase D
14	9612.ENSCAFP00000016804	0.955	Prostaglandin I2 (prostacyclin) synthase
15	9612.ENSCAFP00000014759	0.954	Belongs to the GST superfamily.
16	9612.ENSCAFP00000000624	0.950	Estrogen receptor
17	9612.ENSCAFP00000005960	0.949	Thromboxane A synthase 1 (platelet)
18	9612.ENSCAFP00000022990	0.944	Histone deacetylase 6
19	9612.ENSCAFP00000022946	0.943	Peptidylprolyl isomerase
20	9612.ENSCAFP00000043090	0.929	Prostaglandin-H2 D-isomerase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070182	0.998	DNA polymerase binding
GO:0051879	0.791	Hsp90 protein binding
GO:0016860	0.599	intramolecular oxidoreductase activity
GO:0050220	0.342	prostaglandin-E synthase activity
GO:0003720	0.331	telomerase activity
GO:0051082	0.328	unfolded protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009058	0.952	biosynthetic process
GO:0044237	0.947	cellular metabolic process
GO:0050789	0.934	regulation of biological process
GO:0048518	0.904	positive regulation of biological process
GO:0019222	0.898	regulation of metabolic process
GO:0051972	0.888	regulation of telomerase activity
GO:0010604	0.879	positive regulation of macromolecule metabolic process
GO:0044085	0.849	cellular component biogenesis
GO:0071704	0.835	organic substance metabolic process
GO:0007004	0.832	telomere maintenance via telomerase
GO:0043933	0.763	protein-containing complex organization
GO:0044093	0.761	positive regulation of molecular function
GO:0048522	0.734	positive regulation of cellular process
GO:0071826	0.720	ribonucleoprotein complex subunit organization
GO:0051173	0.707	positive regulation of nitrogen compound metabolic process
GO:0031325	0.704	positive regulation of cellular metabolic process
GO:0022607	0.680	cellular component assembly
GO:2000573	0.644	positive regulation of DNA biosynthetic process
GO:0065003	0.549	protein-containing complex assembly
GO:0051347	0.335	positive regulation of transferase activity
GO:0022613	0.329	ribonucleoprotein complex biogenesis
GO:0022618	0.321	ribonucleoprotein complex assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.994	intracellular organelle
GO:0043231	0.943	intracellular membrane-bounded organelle
GO:0043228	0.937	non-membrane-bounded organelle
GO:0032991	0.919	protein-containing complex
GO:0043232	0.915	intracellular non-membrane-bounded organelle
GO:0005634	0.889	nucleus
GO:0005829	0.877	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.3.-.-	0.599	Intramolecular oxidoreductases.
RHEA:12893	0.342	prostaglandin H2 = prostaglandin E2
EC:5.3.99.3	0.342	prostaglandin-E synthase.
EC:2.7.7.49	0.331	RNA-directed DNA polymerase.

[back to server]