StarFunc result for job id Q15233

User Input

>input (471 residues)
MQSNKTFNLEKQNHTPRKHHQHHHQQQHHQQQQQQPPPPPIPANGQQASSQNEGLTIDLK
NFRKPGEKTFTQRSRLFVGNLPPDITEEEMRKLFEKYGKAGEVFIHKDKGFGFIRLETRT
LAEIAKVELDNMPLRGKQLRVRFACHSASLTVRNLPQYVSNELLEEAFSVFGQVERAVVI
VDDRGRPSGKGIVEFSGKPAARKALDRCSEGSFLLTTFPRPVTVEPMDQLDDEEGLPEKL
VIKNQQFHKEREQPPRFAQPGSFEYEYAMRWKALIEMEKQQQDQVDRNIKEAREKLEMEM
EAARHEHQVMLMRQDLMRRQEELRRMEELHNQEVQKRKQLELRQEEERRRREEEMRRQQE
EMMRRQQEGFKGTFPDAREQEIRMGQMAMGGAMGINNRGAMPPAPVPAGTPAPPGPATMM
PDGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5FVM4	0.758	0.750	2.419E-70	476	0.989	0.979	Q5FVM4.pdb.gz	NONO_RAT Non-POU domain-containing octamer-binding protein OS=Rattus norvegicus OX=10116 GN=Nono PE=1 SV=3
2	AFDB:Q802Z5	0.705	0.752	6.492E-52	441	0.631	0.673	Q802Z5.pdb.gz	Q802Z5_DANRE Non-POU domain-containing octamer-binding protein OS=Danio rerio OX=7955 GN=wu:fb40d10 PE=1 SV=1
3	AFDB:Q8R326	0.674	0.609	3.796E-49	523	0.601	0.541	Q8R326.pdb.gz	PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus OX=10090 GN=Pspc1 PE=1 SV=1
4	AFDB:A0A384N5Z8	0.639	0.435	2.261E-47	707	0.592	0.395	A0A384N5Z8.pdb.gz	A0A384N5Z8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
5	AFDB:Q1L8R2	0.625	0.465	1.548E-46	638	0.544	0.401	Q1L8R2.pdb.gz
6	AFDB:Q9U1N0	0.564	0.502	6.131E-36	535	0.344	0.303	Q9U1N0.pdb.gz	HRP65_CHITE Hrp65 protein OS=Chironomus tentans OX=7153 GN=HRP65 PE=1 SV=1
7	AFDB:B3GWA1	0.546	0.458	2.993E-33	562	0.335	0.281	B3GWA1.pdb.gz	B3GWA1_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
8	AFDB:Q04047	0.567	0.393	1.193E-32	700	0.350	0.236	Q04047.pdb.gz	NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster OX=7227 GN=nonA PE=1 SV=2
9	AFDB:Q39061	0.182	0.254	3.763E-13	329	0.108	0.155	Q39061.pdb.gz	CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP33 PE=2 SV=1
10	AFDB:O64380	0.174	0.129	5.398E-13	660	0.102	0.073	O64380.pdb.gz	PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=PAB3 PE=2 SV=1
11	PDB:6y53o	0.156	0.438	3.346E-10	160	0.089	0.263	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
12	PDB:5vsuA	0.171	0.203	3.773E-10	387	0.072	0.088	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
13	PDB:7oqcF	0.151	0.259	1.255E-9	267	0.066	0.116	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
14	PDB:6y5qq	0.151	0.376	4.177E-9	178	0.098	0.258	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:7evoD	0.158	0.362	8.434E-8	200	0.093	0.220	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:6ff7X	0.143	0.378	1.010E-7	171	0.066	0.181	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
17	PDB:6r5kH	0.159	0.188	1.634E-7	394	0.115	0.137	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
18	PDB:5lsbA	0.177	0.410	1.956E-7	176	0.076	0.205	5lsbA.pdb.gz
19	PDB:6n7pA	0.145	0.358	2.002E-5	186	0.040	0.102	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
20	PDB:3lqvB	0.152	0.598	2.126E-5	115	0.042	0.174	3lqvB.pdb.gz	Branch Recognition by SF3b14

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4Z9	0.0	959	471	1.000	1.000	A0A0S2Z4Z9_HUMAN Non-POU domain containing octamer-binding isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=2 SV=1
2	Q15233	0.0	959	471	1.000	1.000	NONO_HUMAN Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=4
3	Q5FVM4	0.0	939	476	0.987	0.977	NONO_RAT Non-POU domain-containing octamer-binding protein OS=Rattus norvegicus OX=10116 GN=Nono PE=1 SV=3
4	Q99K48	0.0	940	473	0.987	0.983	NONO_MOUSE Non-POU domain-containing octamer-binding protein OS=Mus musculus OX=10090 GN=Nono PE=1 SV=3
5	Q802Z5	6.82e-177	504	441	0.620	0.662	Q802Z5_DANRE Non-POU domain-containing octamer-binding protein OS=Danio rerio OX=7955 GN=wu:fb40d10 PE=1 SV=1
6	Q8R326	1.95e-157	458	523	0.537	0.484	PSPC1_MOUSE Paraspeckle component 1 OS=Mus musculus OX=10090 GN=Pspc1 PE=1 SV=1
7	Q8WXF1	2.18e-156	456	523	0.535	0.482	PSPC1_HUMAN Paraspeckle component 1 OS=Homo sapiens OX=9606 GN=PSPC1 PE=1 SV=1
8	A0A384N5Z8	1.53e-151	449	707	0.503	0.335	A0A384N5Z8_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
9	P23246	1.53e-151	449	707	0.503	0.335	SFPQ_HUMAN Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2
10	Q8VIJ6	9.95e-151	447	699	0.490	0.330	SFPQ_MOUSE Splicing factor, proline- and glutamine-rich OS=Mus musculus OX=10090 GN=Sfpq PE=1 SV=1
11	Q4KM71	1.01e-150	447	699	0.490	0.330	Q4KM71_RAT Splicing factor proline and glutamine rich OS=Rattus norvegicus OX=10116 GN=Sfpq PE=1 SV=1
12	C9IZL7	1.71e-150	428	207	0.439	1.000	C9IZL7_HUMAN Non-POU domain-containing octamer-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=1
13	Q6NUU2	2.67e-147	436	619	0.488	0.372	Q6NUU2_DANRE Splicing factor proline/glutamine rich (Polypyrimidine tract binding protein associated) OS=Danio rerio OX=7955 GN=zgc:85935 PE=1 SV=1
14	Q9U1N0	1.99e-80	261	535	0.295	0.260	HRP65_CHITE Hrp65 protein OS=Chironomus tentans OX=7153 GN=HRP65 PE=1 SV=1
15	C9J4X2	1.22e-79	245	124	0.263	1.000	C9J4X2_HUMAN Non-POU domain-containing octamer-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=1
16	Q04047	1.09e-78	260	700	0.306	0.206	NONA_DROME Protein no-on-transient A OS=Drosophila melanogaster OX=7227 GN=nonA PE=1 SV=2
17	B3GWA1	3.18e-74	245	562	0.257	0.215	B3GWA1_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
18	Q8I7K5	1.86e-69	227	374	0.238	0.299	Q8I7K5_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1
19	C9JJ13	1.36e-37	133	65	0.138	1.000	C9JJ13_HUMAN Non-POU domain-containing octamer-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=NONO PE=1 SV=8
20	B3GWA0	1.44e-16	82.0	282	0.081	0.135	B3GWA0_CAEEL NOPS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nono-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08075 NOPS	2.4e-23	93.3	NOPS (NUC059) domain
2	PF00076 RRM_1	9.6e-28	107.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF13893 RRM_5	2.6e+02	12.7	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	0.083	24.3	RNA recognition motif
5	PF16842 RRM_occluded	15	16.8	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000001661

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013209	0.987	Splicing factor proline/glutamine-rich
2	61853.ENSNLEP00000001565	0.973	Paraspeckle component 1
3	61853.ENSNLEP00000011118	0.916	Uncharacterized protein
4	61853.ENSNLEP00000002256	0.796	Heterogeneous nuclear ribonucleoprotein M
5	61853.ENSNLEP00000012055	0.784	Period circadian clock 1
6	61853.ENSNLEP00000014973	0.770	Interleukin enhancer binding factor 3, 90kDa
7	61853.ENSNLEP00000007523	0.760	RNA binding motif protein 14
8	61853.ENSNLEP00000013720	0.735	Period circadian clock 2
9	61853.ENSNLEP00000010736	0.729	Parkinsonism associated deglycase
10	61853.ENSNLEP00000012243	0.721	Possesses 5'->3' exoribonuclease activity. May promote termination of transcription by RNA polymerase II.
11	61853.ENSNLEP00000019732	0.697	FUS RNA binding protein
12	61853.ENSNLEP00000003193	0.693	SRY-box 9
13	61853.ENSNLEP00000014778	0.692	Wiskott-Aldrich syndrome-like
14	61853.ENSNLEP00000007880	0.659	Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex. Introduces a single-strand break via transesterification at the specific target site 5'-[CT]CCTTp site in duplex DNA. The scissile phosphodiester is attacked by the catalytic tyrosine of the enzyme, resulting in the formation of a DNA-(3'-phosphotyrosyl)-enzyme intermediate and the expulsion of a 5'-OH DNA strand. The free DNA strand then undergoes passage around the unbroken strand thus removing DNA supercoil [...]
15	61853.ENSNLEP00000015131	0.658	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
16	61853.ENSNLEP00000001525	0.639	Mab-21 domain containing 1
17	61853.ENSNLEP00000020988	0.638	Nuclear receptor subfamily 5, group A, member 1
18	61853.ENSNLEP00000002411	0.609	Nudix hydrolase 21
19	61853.ENSNLEP00000000665	0.601	Uncharacterized protein
20	61853.ENSNLEP00000008338	0.594	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0048519	0.992	negative regulation of biological process
GO:0050794	0.991	regulation of cellular process
GO:0048523	0.982	negative regulation of cellular process
GO:0009987	0.961	cellular process
GO:0071704	0.907	organic substance metabolic process
GO:0006807	0.892	nitrogen compound metabolic process
GO:0019222	0.886	regulation of metabolic process
GO:0060255	0.878	regulation of macromolecule metabolic process
GO:0044238	0.873	primary metabolic process
GO:0044237	0.842	cellular metabolic process
GO:0043170	0.827	macromolecule metabolic process
GO:0031323	0.825	regulation of cellular metabolic process
GO:0080090	0.819	regulation of primary metabolic process
GO:0051171	0.819	regulation of nitrogen compound metabolic process
GO:0010468	0.806	regulation of gene expression
GO:0019219	0.784	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.781	positive regulation of biological process
GO:0034641	0.692	cellular nitrogen compound metabolic process
GO:0051252	0.649	regulation of RNA metabolic process
GO:1901360	0.600	organic cyclic compound metabolic process
GO:0046483	0.599	heterocycle metabolic process
GO:0006725	0.594	cellular aromatic compound metabolic process
GO:0006139	0.582	nucleobase-containing compound metabolic process
GO:0010605	0.535	negative regulation of macromolecule metabolic process
GO:0051172	0.526	negative regulation of nitrogen compound metabolic process
GO:0090304	0.515	nucleic acid metabolic process
GO:0010556	0.485	regulation of macromolecule biosynthetic process
GO:0031326	0.485	regulation of cellular biosynthetic process
GO:0006355	0.449	regulation of DNA-templated transcription
GO:0031324	0.444	negative regulation of cellular metabolic process
GO:0006396	0.439	RNA processing
GO:0048511	0.434	rhythmic process
GO:0048522	0.411	positive regulation of cellular process
GO:0050896	0.349	response to stimulus
GO:0016071	0.323	mRNA metabolic process
GO:0008380	0.301	RNA splicing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0032991	0.965	protein-containing complex
GO:0001650	0.831	fibrillar center
GO:0140513	0.750	nuclear protein-containing complex
GO:0005737	0.733	cytoplasm
GO:0016020	0.663	membrane
GO:0016604	0.404	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]