StarFunc result for job id Q15257

User Input

>input (358 residues)
MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVK
GKKLTFEYRVSEMWNEVHEEKEQAAKQSVSCDECIPLPRAGHCAPSEAIEKLVALLNTLD
RWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGN
STRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAG
SQGVWGLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKT
GPFAEHSNQLWNISAVPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15257	1.000	1.000	3.343E-57	358	1.000	1.000	Q15257.pdb.gz	PTPA_HUMAN Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA PE=1 SV=3
2	AFDB:A6PVN5	0.874	0.950	3.911E-48	329	0.902	0.982	A6PVN5.pdb.gz	A6PVN5_HUMAN Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA PE=1 SV=1
3	PDB:2hv6A	0.831	0.987	2.074E-42	301	0.841	1.000	2hv6A.pdb.gz	Structure and mechanism of the phosphotyrosyl phosphatase activator.
4	AFDB:Q24466	0.818	0.737	2.274E-28	398	0.413	0.372	Q24466.pdb.gz	Q24466_DROME Serine/threonine-protein phosphatase 2A activator OS=Drosophila melanogaster OX=7227 GN=Ptpa PE=2 SV=1
5	AFDB:O36016	0.823	0.905	1.377E-25	325	0.366	0.403	O36016.pdb.gz	PTPA1_SCHPO Serine/threonine-protein phosphatase 2A activator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrd1 PE=3 SV=1
6	AFDB:Q9P7H4	0.800	0.814	3.558E-25	352	0.335	0.341	Q9P7H4.pdb.gz	PTPA2_SCHPO Serine/threonine-protein phosphatase 2A activator 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrd2 PE=3 SV=1
7	AFDB:Q8ILG3	0.771	0.862	1.477E-24	319	0.288	0.323	Q8ILG3.pdb.gz	Q8ILG3_PLAF7 Serine/threonine-protein phosphatase 2A activator OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1430100 PE=3 SV=1
8	AFDB:Q12461	0.788	0.788	6.433E-24	358	0.310	0.310	Q12461.pdb.gz	PTPA2_YEAST Serine/threonine-protein phosphatase 2A activator 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRD2 PE=1 SV=1
9	AFDB:P40454	0.747	0.682	4.502E-23	393	0.338	0.308	P40454.pdb.gz	PTPA1_YEAST Serine/threonine-protein phosphatase 2A activator 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRD1 PE=1 SV=1
10	AFDB:P51450	0.114	0.086	2.612E-1	516	0.089	0.062	P51450.pdb.gz	RORG_MOUSE Nuclear receptor ROR-gamma OS=Mus musculus OX=10090 GN=Rorc PE=1 SV=1
11	AFDB:Q8GYE8	0.085	0.067	3.312E-1	567	0.092	0.058	Q8GYE8.pdb.gz	NSUN5_ARATH 25S rRNA (cytosine-C(5))-methyltransferase NSUN5 OS=Arabidopsis thaliana OX=3702 GN=NSUN5 PE=1 SV=1
12	PDB:6h61A	0.125	0.078	5.520E-1	660	0.056	0.030	6h61A.pdb.gz	Cryo-EM Structures of MDA5-dsRNA Filaments at Different Stages of ATP Hydrolysis.
13	PDB:7bkpA	0.120	0.075	6.069E-1	689	0.053	0.028	7bkpA.pdb.gz	MDA5 disease variant M854K prevents ATP-dependent structural discrimination of viral and cellular RNA.
14	PDB:7tnxA	0.118	0.077	8.461E-1	647	0.053	0.029	7tnxA.pdb.gz	The RIG-I receptor adopts two different conformations for distinguishing host from viral RNA ligands.
15	PDB:2bb5A	0.160	0.146	1.179	409	0.089	0.078	2bb5A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
16	PDB:3fwnA	0.101	0.083	1.237	467	0.078	0.060	3fwnA.pdb.gz	Conformational changes associated with cofactor/substrate binding of 6-phosphogluconate dehydrogenase from Escherichia coli and Klebsiella pneumoniae: Implications for enzyme mechanism
17	PDB:7nvoZ	0.115	0.123	1.297	323	0.087	0.096	7nvoZ.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
18	PDB:2byvE	0.152	0.072	1.360	922	0.089	0.035	2byvE.pdb.gz
19	PDB:3ts7B	0.121	0.124	1.568	297	0.101	0.121	3ts7B.pdb.gz
20	PDB:3v2uC	0.093	0.069	1.896	516	0.064	0.045	3v2uC.pdb.gz	The Gal3p transducer of the GAL regulon interacts with the Gal80p repressor in its ligand-induced closed conformation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6PVN5	0.0	650	329	0.902	0.982	A6PVN5_HUMAN Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA PE=1 SV=1
2	F6WIT2	0.0	586	288	0.804	1.000	F6WIT2_HUMAN Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA PE=1 SV=1
3	Q15257	0.0	750	358	1.000	1.000	PTPA_HUMAN Serine/threonine-protein phosphatase 2A activator OS=Homo sapiens OX=9606 GN=PTPA PE=1 SV=3
4	Q9VQQ0	7.57e-97	295	398	0.408	0.367	Q9VQQ0_DROME Serine/threonine-protein phosphatase 2A activator OS=Drosophila melanogaster OX=7227 GN=Ptpa PE=1 SV=1
5	Q24466	8.44e-97	295	398	0.411	0.369	Q24466_DROME Serine/threonine-protein phosphatase 2A activator OS=Drosophila melanogaster OX=7227 GN=Ptpa PE=2 SV=1
6	H0Y6E5	8.01e-72	224	218	0.302	0.495	H0Y6E5_HUMAN Serine/threonine-protein phosphatase 2A activator (Fragment) OS=Homo sapiens OX=9606 GN=PTPA PE=1 SV=1
7	O36016	4.39e-71	226	325	0.366	0.403	PTPA1_SCHPO Serine/threonine-protein phosphatase 2A activator 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrd1 PE=3 SV=1
8	Q9P7H4	2.33e-67	218	352	0.344	0.349	PTPA2_SCHPO Serine/threonine-protein phosphatase 2A activator 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrd2 PE=3 SV=1
9	P40454	3.40e-65	213	393	0.335	0.305	PTPA1_YEAST Serine/threonine-protein phosphatase 2A activator 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRD1 PE=1 SV=1
10	Q12461	2.45e-60	199	358	0.321	0.321	PTPA2_YEAST Serine/threonine-protein phosphatase 2A activator 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRD2 PE=1 SV=1
11	Q8ILG3	3.58e-53	180	319	0.282	0.317	Q8ILG3_PLAF7 Serine/threonine-protein phosphatase 2A activator OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1430100 PE=3 SV=1
12	P0AFJ7	2.1	32.7	499	0.064	0.046	PITA_ECOLI Low-affinity inorganic phosphate transporter PitA OS=Escherichia coli (strain K12) OX=83333 GN=pitA PE=1 SV=1
13	E1JIU2	7.7	30.8	526	0.067	0.046	E1JIU2_DROME Inwardly rectifying potassium channel 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Irk1 PE=1 SV=1
14	A0A0B4JCZ2	7.9	30.8	540	0.067	0.044	A0A0B4JCZ2_DROME Inwardly rectifying potassium channel 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Irk1 PE=1 SV=1
15	A8JR87	7.9	30.8	555	0.067	0.043	A8JR87_DROME FI16807p1 OS=Drosophila melanogaster OX=7227 GN=Irk1 PE=1 SV=1
16	Q95UP7	8.3	30.8	422	0.067	0.057	Q95UP7_DROME Potassium inwardly rectifying channel DIR OS=Drosophila melanogaster OX=7227 GN=Irk1 PE=2 SV=1
17	Q9VCQ0	8.3	30.8	532	0.067	0.045	Q9VCQ0_DROME Inwardly rectifying K+ channel protein OS=Drosophila melanogaster OX=7227 GN=Irk1 PE=1 SV=1
18	A0A0B4KH86	9.4	30.8	652	0.067	0.037	A0A0B4KH86_DROME Inwardly rectifying potassium channel 1, isoform F OS=Drosophila melanogaster OX=7227 GN=Irk1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03095 PTPA	3.7e-119	409.3	Phosphotyrosyl phosphate activator (PTPA) protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000018852

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000006910	0.992	Protein phosphatase 2, catalytic subunit, alpha isozyme
2	9555.ENSPANP00000013336	0.992	V-akt murine thymoma viral oncogene homolog 1
3	9555.ENSPANP00000010005	0.979	Protein phosphatase 2, regulatory subunit A, alpha
4	9555.ENSPANP00000018106	0.964	Protein phosphatase 2, regulatory subunit A, beta
5	9555.ENSPANP00000003412	0.952	Protein phosphatase 2, catalytic subunit, beta isozyme
6	9555.ENSPANP00000002368	0.945	V-akt murine thymoma viral oncogene homolog 3
7	9555.ENSPANP00000019397	0.942	Protein phosphatase 6, catalytic subunit
8	9555.ENSPANP00000003154	0.931	annotation not available
9	9555.ENSPANP00000000500	0.928	Demethylates proteins that have been reversibly carboxymethylated
10	9555.ENSPANP00000004895	0.928	Papio anubis v-akt murine thymoma viral oncogene homolog 2 (AKT2), mRNA
11	9555.ENSPANP00000009069	0.928	Shugoshin-like 1 (S. pombe)
12	9555.ENSPANP00000012503	0.904	Protein phosphatase 4, catalytic subunit
13	9555.ENSPANP00000009015	0.903	The B regulatory subunit might modulate substrate selectivity and catalytic activity, and also might direct the localization of the catalytic enzyme to a particular subcellular compartment.
14	9555.ENSPANP00000018353	0.902	Protein phosphatase 2, regulatory subunit B, alpha
15	9555.ENSPANP00000002375	0.895	Protein phosphatase 4, regulatory subunit 1
16	9555.ENSPANP00000014539	0.895	annotation not available
17	9555.ENSPANP00000019550	0.893	Misshapen-like kinase 1
18	9555.ENSPANP00000016321	0.884	BUB1 mitotic checkpoint serine/threonine kinase B
19	9555.ENSPANP00000015174	0.876	MLX interacting protein-like
20	9555.ENSPANP00000013134	0.875	Protein phosphatase 4, regulatory subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019888	1.000	protein phosphatase regulator activity
GO:0051721	1.000	protein phosphatase 2A binding
GO:0005102	0.998	signaling receptor binding
GO:0005524	0.998	ATP binding
GO:0019211	0.997	phosphatase activator activity
GO:0042803	0.996	protein homodimerization activity
GO:0004721	0.996	phosphoprotein phosphatase activity
GO:0072542	0.993	protein phosphatase activator activity
GO:0008160	0.943	protein tyrosine phosphatase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.985	positive regulation of cellular process
GO:0048523	0.971	negative regulation of cellular process
GO:0060255	0.970	regulation of macromolecule metabolic process
GO:0051171	0.967	regulation of nitrogen compound metabolic process
GO:0080090	0.966	regulation of primary metabolic process
GO:0031323	0.966	regulation of cellular metabolic process
GO:0031325	0.963	positive regulation of cellular metabolic process
GO:0051173	0.948	positive regulation of nitrogen compound metabolic process
GO:0010604	0.942	positive regulation of macromolecule metabolic process
GO:0010562	0.935	positive regulation of phosphorus metabolic process
GO:0045937	0.933	positive regulation of phosphate metabolic process
GO:0044093	0.911	positive regulation of molecular function
GO:0031399	0.910	regulation of protein modification process
GO:0051247	0.909	positive regulation of protein metabolic process
GO:0031401	0.900	positive regulation of protein modification process
GO:0043085	0.899	positive regulation of catalytic activity
GO:0051336	0.799	regulation of hydrolase activity
GO:0035304	0.794	regulation of protein dephosphorylation
GO:0010921	0.791	regulation of phosphatase activity
GO:0035306	0.791	positive regulation of dephosphorylation
GO:0035305	0.791	negative regulation of dephosphorylation
GO:0051345	0.753	positive regulation of hydrolase activity
GO:0010941	0.712	regulation of cell death
GO:0035308	0.665	negative regulation of protein dephosphorylation
GO:0043666	0.649	regulation of phosphoprotein phosphatase activity
GO:0010923	0.649	negative regulation of phosphatase activity
GO:0035307	0.649	positive regulation of protein dephosphorylation
GO:0010942	0.571	positive regulation of cell death
GO:0010922	0.564	positive regulation of phosphatase activity
GO:0009987	0.416	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.704	cytoplasm
GO:0016020	0.525	membrane
GO:0032991	0.423	protein-containing complex
GO:0012505	0.394	endomembrane system
GO:0071944	0.300	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	0.997	Phosphoric monoester hydrolases.

[back to server]