StarFunc result for job id Q15262

User Input

>input (1439 residues)
MDTTAAAALPAFVALLLLSPWPLLGSAQGQFSAGGCTFDDGPGACDYHQDLYDDFEWVHV
SAQEPHYLPPEMPQGSYMIVDSSDHDPGEKARLQLPTMKENDTHCIDFSYLLYSQKGLNP
GTLNILVRVNKGPLANPIWNVTGFTGRDWLRAELAVSTFWPNEYQVIFEAEVSGGRSGYI
AIDDIQVLSYPCDKSPHFLRLGDVEVNAGQNATFQCIATGRDAVHNKLWLQRRNGEDIPV
AQTKNINHRRFAASFRLQEVTKTDQDLYRCVTQSERGSGVSNFAQLIVREPPRPIAPPQL
LGVGPTYLLIQLNANSIIGDGPIILKEVEYRMTSGSWTETHAVNAPTYKLWHLDPDTEYE
IRVLLTRPGEGGTGLPGPPLITRTKCAEPMRTPKTLKIAEIQARRIAVDWESLGYNITRC
HTFNVTICYHYFRGHNESKADCLDMDPKAPQHVVNHLPPYTNVSLKMILTNPEGRKESEE
TIIQTDEDVPGPVPVKSLQGTSFENKIFLNWKEPLDPNGIITQYEISYSSIRSFDPAVPV
AGPPQTVSNLWNSTHHVFMHLHPGTTYQFFIRASTVKGFGPATAINVTTNISAPTLPDYE
GVDASLNETATTITVLLRPAQAKGAPISAYQIVVEELHPHRTKREAGAMECYQVPVTYQN
AMSGGAPYYFAAELPPGNLPEPAPFTVGDNRTYQGFWNPPLAPRKGYNIYFQAMSSVEKE
TKTQCVRIATKAATEEPEVIPDPAKQTDRVVKIAGISAGILVFILLLLVVILIVKKSKLA
KKRKDAMGNTRQEMTHMVNAMDRSYADQSTLHAEDPLSITFMDQHNFSPRYENHSATAES
SRLLDVPRYLCEGTESPYQTGQLHPAIRVADLLQHINLMKTSDSYGFKEEYESFFEGQSA
SWDVAKKDQNRAKNRYGNIIAYDHSRVILQPVEDDPSSDYINANYIDGYQRPSHYIATQG
PVHETVYDFWRMIWQEQSACIVMVTNLVEVGRVKCYKYWPDDTEVYGDFKVTCVEMEPLA
EYVVRTFTLERRGYNEIREVKQFHFTGWPDHGVPYHATGLLSFIRRVKLSNPPSAGPIVV
HCSAGAGRTGCYIVIDIMLDMAEREGVVDIYNCVKALRSRRINMVQTEEQYIFIHDAILE
ACLCGETAIPVCEFKAAYFDMIRIDSQTNSSHLKDEFQTLNSVTPRLQAEDCSIACLPRN
HDKNRFMDMLPPDRCLPFLITIDGESSNYINAALMDSYRQPAAFIVTQYPLPNTVKDFWR
LVYDYGCTSIVMLNEVDLSQGCPQYWPEEGMLRYGPIQVECMSCSMDCDVINRIFRICNL
TRPQEGYLMVQQFQYLGWASHREVPGSKRSFLKLILQVEKWQEECEEGEGRTIIHCLNGG
GRSGMFCAIGIVVEMVKRQNVVDVFHAVKTLRNSKPNMVEAPEQYRFCYDVALEYLESS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B1AUH1	0.498	0.495	0.000	1446	0.588	0.585	B1AUH1.pdb.gz	PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus OX=10090 GN=Ptpru PE=1 SV=1
2	AFDB:B3DK56	0.487	0.485	0.000	1444	0.577	0.575	B3DK56.pdb.gz	PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio OX=7955 GN=ptpru PE=2 SV=1
3	AFDB:F1LXJ9	0.406	0.459	0.000	1269	0.545	0.618	F1LXJ9.pdb.gz	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
4	AFDB:P28827	0.489	0.485	0.000	1452	0.610	0.605	P28827.pdb.gz	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
5	AFDB:P35822	0.463	0.458	0.000	1457	0.987	0.975	P35822.pdb.gz	PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus OX=10090 GN=Ptprk PE=1 SV=1
6	AFDB:F1NWE3	0.395	0.375	7.251E-98	1516	0.272	0.259	F1NWE3.pdb.gz	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
7	AFDB:P23468	0.397	0.300	8.860E-95	1912	0.284	0.213	P23468.pdb.gz	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
8	AFDB:F1QJW2	0.395	0.298	8.861E-94	1918	0.276	0.207	F1QJW2.pdb.gz
9	AFDB:A0A0H2UKT5	0.400	0.302	2.294E-93	1914	0.271	0.204	A0A0H2UKT5.pdb.gz
10	AFDB:Q13332	0.396	0.294	2.411E-93	1948	0.277	0.205	Q13332.pdb.gz	PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3
11	PDB:4gwfA	0.174	0.492	1.512E-25	497	0.079	0.229	4gwfA.pdb.gz
12	PDB:3ps5A	0.180	0.479	1.590E-24	529	0.082	0.223	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:5xzrA	0.181	0.493	2.042E-24	519	0.083	0.231	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
14	PDB:6krwA	0.170	0.764	2.147E-20	306	0.060	0.281	6krwA.pdb.gz
15	PDB:3m4uA	0.161	0.762	6.462E-16	285	0.062	0.312	3m4uA.pdb.gz
16	PDB:5oj2B	0.107	0.189	9.174E-15	692	0.057	0.118	5oj2B.pdb.gz
17	PDB:6pxvA	0.139	0.231	2.760E-12	823	0.040	0.069	6pxvA.pdb.gz
18	PDB:8eyyA	0.153	0.261	3.051E-12	775	0.033	0.062	8eyyA.pdb.gz
19	PDB:6pyhD	0.138	0.233	3.545E-12	798	0.044	0.080	6pyhD.pdb.gz
20	PDB:7q5zA	0.078	0.082	3.727E-12	1344	0.058	0.062	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3H0	1752	1430	0.589	0.592	A0A0G2K3H0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpru PE=3 SV=2
2	A0A8I5ZW41	1731	1465	0.580	0.570	A0A8I5ZW41_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
3	A0A8I6AFL3	1739	1455	0.580	0.574	A0A8I6AFL3_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=3 SV=1
4	A0A8J8XMU1	872	492	0.293	0.856	A0A8J8XMU1_RAT Receptor-type tyrosine-protein phosphatase kappa OS=Rattus norvegicus OX=10116 GN=Ptprk PE=1 SV=1
5	A5HV10	1487	709	0.489	0.993	A5HV10_RAT Receptor-like protein tyrosine phosphatase kappa (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
6	A5I9F0	2984	1439	0.985	0.985	A5I9F0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
7	B1AUH1	1776	1446	0.595	0.592	PTPRU_MOUSE Receptor-type tyrosine-protein phosphatase U OS=Mus musculus OX=10090 GN=Ptpru PE=1 SV=1
8	B3DK56	1708	1444	0.586	0.584	PTPRU_DANRE Receptor-type tyrosine-protein phosphatase U OS=Danio rerio OX=7955 GN=ptpru PE=2 SV=1
9	E7EPS8	1825	1390	0.604	0.625	E7EPS8_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
10	E9PGC5	2984	1472	0.999	0.976	E9PGC5_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1
11	F1LXJ9	1743	1454	0.582	0.576	F1LXJ9_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprt PE=1 SV=3
12	F1MAG7	1704	1380	0.577	0.601	F1MAG7_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpru PE=3 SV=2
13	H0Y6P5	645	343	0.220	0.921	H0Y6P5_HUMAN Protein tyrosine phosphatase receptor type K (Fragment) OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1
14	O14522	1750	1441	0.582	0.582	PTPRT_HUMAN Receptor-type tyrosine-protein phosphatase T OS=Homo sapiens OX=9606 GN=PTPRT PE=1 SV=6
15	P28827	1845	1452	0.614	0.608	PTPRM_HUMAN Receptor-type tyrosine-protein phosphatase mu OS=Homo sapiens OX=9606 GN=PTPRM PE=1 SV=2
16	P28828	1847	1452	0.616	0.610	PTPRM_MOUSE Receptor-type tyrosine-protein phosphatase mu OS=Mus musculus OX=10090 GN=Ptprm PE=1 SV=2
17	P35822	2963	1457	0.986	0.974	PTPRK_MOUSE Receptor-type tyrosine-protein phosphatase kappa OS=Mus musculus OX=10090 GN=Ptprk PE=1 SV=1
18	Q15262	3018	1439	1.000	1.000	PTPRK_HUMAN Receptor-type tyrosine-protein phosphatase kappa OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=2
19	Q5TG12	2994	1458	0.999	0.986	Q5TG12_HUMAN protein-tyrosine-phosphatase OS=Homo sapiens OX=9606 GN=PTPRK PE=1 SV=1
20	Q92729	1783	1446	0.598	0.595	PTPRU_HUMAN Receptor-type tyrosine-protein phosphatase U OS=Homo sapiens OX=9606 GN=PTPRU PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	0.00032	31.9	Dual specificity phosphatase, catalytic domain
2	PF15820 ECSCR	2.3e+02	13.0	Endothelial cell-specific chemotaxis regulator
3	PF14575 EphA2_TM	15	17.7	Ephrin type-A receptor 2 transmembrane domain
4	PF00041 fn3	1.4e-21	87.9	Fibronectin type III domain
5	PF07679 I-set	0.0017	29.7	Immunoglobulin I-set domain
6	PF00047 ig	0.33	22.5	Immunoglobulin domain
7	PF13895 Ig_2	38	16.0	Immunoglobulin domain
8	PF13927 Ig_3	0.044	25.6	Immunoglobulin domain
9	PF08391 Ly49	77	15.1	Ly49-like protein, N-terminal region
10	PF00629 MAM	3.7e-31	119.6	MAM domain, meprin/A5/mu
11	PF08374 Protocadherin	3.5e+02	12.6	Protocadherin
12	PF14566 PTPlike_phytase	24	16.5	Inositol hexakisphosphate
13	PF18861 PTP_tm	99	14.7	TM proximal of protein tyrosine phosphatase, receptor type J
14	PF07686 V-set	3.2e+02	12.9	Immunoglobulin V-set domain
15	PF00102 Y_phosphatase	3.9e-148	502.9	Protein-tyrosine phosphatase
16	PF13350 Y_phosphatase3	0.33	22.5	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357196

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.968	Epidermal growth factor receptor
2	9606.ENSP00000376345	0.927	Growth factor receptor-bound protein 2
3	9606.ENSP00000265171	0.917	Pro-epidermal growth factor
4	9606.ENSP00000264033	0.916	E3 ubiquitin-protein ligase CBL
5	9606.ENSP00000295400	0.911	Protransforming growth factor alpha
6	9606.ENSP00000304697	0.905	Polyubiquitin-B
7	9606.ENSP00000388107	0.905	Ubiquitin-60S ribosomal protein L40
8	9606.ENSP00000230990	0.903	Proheparin-binding EGF-like growth factor
9	9606.ENSP00000272317	0.903	Ubiquitin-40S ribosomal protein S27a
10	9606.ENSP00000244869	0.902	Proepiregulin
11	9606.ENSP00000379092	0.902	Probetacellulin
12	9606.ENSP00000441543	0.901	Polyubiquitin-C
13	9606.ENSP00000379097	0.900	Amphiregulin
14	9606.ENSP00000411898	0.900	Epigen
15	9606.ENSP00000349131	0.707	R-spondin-3
16	9606.ENSP00000346986	0.655	WW domain-containing adapter protein with coiled-coil
17	9606.ENSP00000280362	0.654	6-pyruvoyl tetrahydrobiopterin synthase
18	9606.ENSP00000358695	0.644	Cytochrome b5 reductase 4
19	9606.ENSP00000400459	0.636	Clathrin coat assembly protein AP180
20	9606.ENSP00000357231	0.633	Protein THEMIS

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0038023	0.883	signaling receptor activity
GO:0004888	0.832	transmembrane signaling receptor activity
GO:0008013	0.662	beta-catenin binding
GO:0019899	0.613	enzyme binding
GO:0050839	0.610	cell adhesion molecule binding
GO:0019900	0.403	kinase binding
GO:0019901	0.356	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.977	metabolic process
GO:0065007	0.950	biological regulation
GO:0016311	0.941	dephosphorylation
GO:0071704	0.922	organic substance metabolic process
GO:0050794	0.915	regulation of cellular process
GO:0006807	0.897	nitrogen compound metabolic process
GO:0043170	0.888	macromolecule metabolic process
GO:0044238	0.886	primary metabolic process
GO:0043412	0.856	macromolecule modification
GO:1901564	0.801	organonitrogen compound metabolic process
GO:0050896	0.778	response to stimulus
GO:0019538	0.767	protein metabolic process
GO:0048856	0.719	anatomical structure development
GO:0006470	0.710	protein dephosphorylation
GO:0032501	0.638	multicellular organismal process
GO:0007155	0.574	cell adhesion
GO:0051716	0.531	cellular response to stimulus
GO:0007165	0.475	signal transduction
GO:0048519	0.456	negative regulation of biological process
GO:0007166	0.431	cell surface receptor signaling pathway
GO:0048518	0.423	positive regulation of biological process
GO:0019222	0.385	regulation of metabolic process
GO:0007167	0.377	enzyme-linked receptor protein signaling pathway
GO:0007275	0.375	multicellular organism development
GO:0071840	0.365	cellular component organization or biogenesis
GO:0060255	0.364	regulation of macromolecule metabolic process
GO:0031323	0.349	regulation of cellular metabolic process
GO:0080090	0.348	regulation of primary metabolic process
GO:0048522	0.344	positive regulation of cellular process
GO:0016043	0.331	cellular component organization
GO:0009966	0.321	regulation of signal transduction
GO:0051171	0.314	regulation of nitrogen compound metabolic process
GO:0048523	0.305	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0030054	0.979	cell junction
GO:0005737	0.673	cytoplasm
GO:0005634	0.357	nucleus
GO:0005576	0.318	extracellular region
GO:0009986	0.309	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]