StarFunc result for job id Q15270

User Input

>input (411 residues)
MDGRAELPAFPRAGAPPLAASDTVPAAPEGAGAARPAAPLRPTSFSVLDILDPNKFNSRR
RRCVLLGPVAPAACAPCASAPCAPAPAASGRPPRAEELERRALAGAGGVGAAGAEPPNAG
DPFKAGEAETNDTNGYSSGGGGHSPSADSGDEVPDDEDDDEDEAPETEAARGAEEARGGG
GGLGARGSGCQGAAETDASPGATVDEAAAPGPRENSPVAQGPPGGAAAPGGAGTTPQGTA
TAAKPKRKRTGSDSKSGKPRRARTAFTYEQLVALENKFKATRYLSVCERLNLALSLSLTE
TQVKIWFQNRRTKWKKQNPGADTSAPTGGGGGPGPGAGPGTGLPGGLSPLSPSPPMGAPL
GMHGPAGYPAHGPGGLVCAAQLPFLSSPAVLSPFVLGSQTYGAPAFYAPHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G3UXB3	0.503	0.512	3.238E-43	402	0.827	0.846	G3UXB3.pdb.gz	NKX11_MOUSE NK1 transcription factor-related protein 1 OS=Mus musculus OX=10090 GN=Nkx1-1 PE=2 SV=2
2	AFDB:A5JNG8	0.175	0.185	9.951E-8	384	0.209	0.224	A5JNG8.pdb.gz	A5JNG8_DANRE Nanog OS=Danio rerio OX=7955 GN=fd20a07 PE=2 SV=1
3	AFDB:P09085	0.150	0.144	1.211E-7	427	0.202	0.194	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
4	AFDB:P10105	0.153	0.103	2.801E-5	635	0.187	0.121	P10105.pdb.gz	LAB_DROME Homeotic protein labial OS=Drosophila melanogaster OX=7227 GN=lab PE=1 SV=2
5	AFDB:Q54F46	0.138	0.072	4.400E-4	803	0.119	0.061	Q54F46.pdb.gz	WARA_DICDI Homeobox protein Wariai OS=Dictyostelium discoideum OX=44689 GN=warA PE=2 SV=1
6	PDB:2hi3A	0.139	0.656	6.903E-3	73	0.039	0.219	2hi3A.pdb.gz
7	AFDB:Q5VR96	0.074	0.071	8.416E-3	437	0.173	0.162	Q5VR96.pdb.gz	Q5VR96_ORYSJ Os06g0275600 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os06g0275600 PE=3 SV=1
8	PDB:4egcA	0.116	0.089	1.516E-2	539	0.039	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
9	AFDB:O94900	0.082	0.067	1.849E-2	526	0.175	0.137	O94900.pdb.gz	TOX_HUMAN Thymocyte selection-associated high mobility group box protein TOX OS=Homo sapiens OX=9606 GN=TOX PE=1 SV=3
10	AFDB:Q7Z353	0.133	0.081	2.566E-2	690	0.148	0.088	Q7Z353.pdb.gz	HDX_HUMAN Highly divergent homeobox OS=Homo sapiens OX=9606 GN=HDX PE=1 SV=1
11	AFDB:Q7K4G8	0.085	0.068	3.124E-2	587	0.197	0.138	Q7K4G8.pdb.gz	Q7K4G8_DROME LD40944p OS=Drosophila melanogaster OX=7227 GN=anon-WO0140519.201 PE=1 SV=1
12	AFDB:O44783	0.077	0.059	3.336E-2	589	0.139	0.097	O44783.pdb.gz	SPY_DROME Protein sprouty OS=Drosophila melanogaster OX=7227 GN=sty PE=1 SV=2
13	PDB:7fbyA	0.099	0.237	3.770E-1	153	0.022	0.059	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5nr5A	0.116	0.362	7.264E-1	113	0.022	0.080	5nr5A.pdb.gz
15	PDB:2cg4A	0.094	0.225	8.843E-1	149	0.019	0.054	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
16	PDB:6id0L	0.121	0.106	1.228	475	0.027	0.023	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
17	PDB:5z56L	0.111	0.132	1.400	342	0.024	0.029	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:2vbwA	0.098	0.225	1.494	147	0.027	0.075	2vbwA.pdb.gz	Mechanistic Insights from the Crystal Structures of a Feast/Famine Regulatory Protein from Mycobacterium Tuberculosis H37Rv.
19	PDB:6dv9F	0.069	0.142	1.819	174	0.039	0.092	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
20	PDB:5yzgL	0.110	0.108	3.283	419	0.027	0.026	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3UXB3	5.31e-164	469	440	0.822	0.768	NKX11_MOUSE NK1 transcription factor-related protein 1 OS=Mus musculus OX=10090 GN=Nkx1-1 PE=2 SV=2
2	P42580	1.33e-41	150	305	0.238	0.321	NKX12_MOUSE NK1 transcription factor-related protein 2 OS=Mus musculus OX=10090 GN=Nkx1-2 PE=1 SV=1
3	P22807	6.17e-38	147	659	0.180	0.112	SLOU_DROME Homeobox protein slou OS=Drosophila melanogaster OX=7227 GN=slou PE=2 SV=1
4	Q22909	7.01e-21	92.8	237	0.151	0.262	HM30_CAEEL Homeobox protein ceh-30 OS=Caenorhabditis elegans OX=6239 GN=ceh-30 PE=2 SV=2
5	F1R2J1	1.78e-20	90.5	182	0.163	0.368	PNX_DANRE Homeobox protein pnx OS=Danio rerio OX=7955 GN=pnx PE=1 SV=1
6	P48031	5.22e-20	92.8	348	0.097	0.115	GBX2_MOUSE Homeobox protein GBX-2 OS=Mus musculus OX=10090 GN=Gbx2 PE=2 SV=1
7	P52951	5.37e-20	92.8	348	0.097	0.115	GBX2_HUMAN Homeobox protein GBX-2 OS=Homo sapiens OX=9606 GN=GBX2 PE=2 SV=3
8	Q6FHY5	5.43e-20	92.0	303	0.122	0.165	Q6FHY5_HUMAN MEOX2 protein OS=Homo sapiens OX=9606 GN=MEOX2 PE=1 SV=1
9	P50222	5.51e-20	92.0	304	0.122	0.164	MEOX2_HUMAN Homeobox protein MOX-2 OS=Homo sapiens OX=9606 GN=MEOX2 PE=1 SV=2
10	Q9UMQ3	9.95e-20	90.5	279	0.127	0.186	BARX2_HUMAN Homeobox protein BarH-like 2 OS=Homo sapiens OX=9606 GN=BARX2 PE=1 SV=3
11	Q9BZE3	1.23e-19	91.3	327	0.095	0.119	BARH1_HUMAN BarH-like 1 homeobox protein OS=Homo sapiens OX=9606 GN=BARHL1 PE=2 SV=1
12	A2CEW5	1.24e-19	91.3	320	0.100	0.128	A2CEW5_DANRE Motor neuron and pancreas homeobox 2b OS=Danio rerio OX=7955 GN=hlxb9lb PE=4 SV=1
13	A9Y2A9	1.39e-19	90.1	282	0.146	0.213	A9Y2A9_DANRE Homeobox protein HMX1 OS=Danio rerio OX=7955 GN=Nkx5-3 PE=2 SV=1
14	O08686	1.45e-19	90.1	283	0.127	0.184	BARX2_MOUSE Homeobox protein BarH-like 2 OS=Mus musculus OX=10090 GN=Barx2 PE=2 SV=2
15	B3DHA2	1.48e-19	90.9	309	0.102	0.136	B3DHA2_DANRE Homeo box HB9 like a OS=Danio rerio OX=7955 GN=hlxb9la PE=2 SV=1
16	F1RCJ6	1.79e-19	90.9	328	0.100	0.125	F1RCJ6_DANRE Motor neuron and pancreas homeobox 2b OS=Danio rerio OX=7955 GN=hlxb9lb PE=4 SV=1
17	P63157	2.02e-19	90.5	327	0.095	0.119	BARH1_MOUSE BarH-like 1 homeobox protein OS=Mus musculus OX=10090 GN=Barhl1 PE=2 SV=1
18	Q8QGU1	2.10e-19	90.9	342	0.100	0.120	Q8QGU1_DANRE Gastrulation brain homeo box 2 OS=Danio rerio OX=7955 GN=fd07f12 PE=2 SV=1
19	P50219	2.45e-19	91.3	401	0.112	0.115	MNX1_HUMAN Motor neuron and pancreas homeobox protein 1 OS=Homo sapiens OX=9606 GN=MNX1 PE=1 SV=3
20	P82976	4.32e-19	90.9	418	0.100	0.098	GBX1_MOUSE Homeobox protein GBX-1 OS=Mus musculus OX=10090 GN=Gbx1 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00046 Homeodomain	1.4e-17	74.6	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000407978

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000429553	0.533	Homeobox protein Nkx-6.3
2	9606.ENSP00000311695	0.529	Coiled-coil domain-containing protein 85B
3	9606.ENSP00000216129	0.519	Tubulin--tyrosine ligase-like protein 12
4	9606.ENSP00000485053	0.518	PP13850

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.999	protein binding
GO:0003700	0.984	DNA-binding transcription factor activity
GO:0000981	0.892	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.724	transcription cis-regulatory region binding
GO:0000977	0.642	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0050794	0.981	regulation of cellular process
GO:0019222	0.893	regulation of metabolic process
GO:0031323	0.879	regulation of cellular metabolic process
GO:0080090	0.860	regulation of primary metabolic process
GO:0009987	0.739	cellular process
GO:0032501	0.736	multicellular organismal process
GO:0032502	0.616	developmental process
GO:0009889	0.535	regulation of biosynthetic process
GO:0060255	0.527	regulation of macromolecule metabolic process
GO:0051171	0.501	regulation of nitrogen compound metabolic process
GO:0008152	0.494	metabolic process
GO:0048856	0.490	anatomical structure development
GO:0044238	0.468	primary metabolic process
GO:0048523	0.458	negative regulation of cellular process
GO:0071704	0.457	organic substance metabolic process
GO:0010468	0.439	regulation of gene expression
GO:0031326	0.438	regulation of cellular biosynthetic process
GO:0019219	0.435	regulation of nucleobase-containing compound metabolic process
GO:0048731	0.434	system development
GO:0010556	0.406	regulation of macromolecule biosynthetic process
GO:0051252	0.406	regulation of RNA metabolic process
GO:0006355	0.404	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043232	0.926	intracellular non-membrane-bounded organelle
GO:0031981	0.773	nuclear lumen
GO:0005654	0.700	nucleoplasm
GO:0005737	0.499	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]