StarFunc result for job id Q15274

User Input

>input (297 residues)
MDAEGLALLLPPVTLAALVDSWLREDCPGLNYAALVSGAGPSQAALWAKSPGVLAGQPFF
DAIFTQLNCQVSWFLPEGSKLVPVARVAEVRGPAHCLLLGERVALNTLARCSGIASAAAA
AVEAARGAGWTGHVAGTRKTTPGFRLVEKYGLLVGGAASHRYDLGGLVMVKDNHVVAAGG
VEKAVRAARQAADFTLKVEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLKAQF
PSVAVEASGGITLDNLPQFCGPHIDVISMGMLTQAAPALDFSLKLFAKEVAPVPKIH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15274	1.000	1.000	1.617E-60	297	1.000	1.000	Q15274.pdb.gz	NADC_HUMAN Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Homo sapiens OX=9606 GN=QPRT PE=1 SV=3
2	PDB:4kwvF	0.973	0.993	2.349E-56	291	0.980	1.000	4kwvF.pdb.gz
3	AFDB:I3LK75	0.968	0.962	1.074E-55	299	0.855	0.849	I3LK75.pdb.gz	NADC_PIG Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Sus scrofa OX=9823 GN=QPRT PE=1 SV=2
4	AFDB:Q5I0M2	0.967	0.960	2.267E-53	299	0.818	0.813	Q5I0M2.pdb.gz	NADC_RAT Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Rattus norvegicus OX=10116 GN=Qprt PE=2 SV=1
5	PDB:4i9aA	0.965	0.995	9.578E-53	288	0.842	0.868	4i9aA.pdb.gz	Crystal structure of Sus scrofa quinolinate phosphoribosyltransferase in complex with nicotinate mononucleotide
6	AFDB:P43619	0.941	0.947	3.716E-34	295	0.438	0.441	P43619.pdb.gz	NADC_YEAST Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA6 PE=1 SV=1
7	AFDB:P77938	0.875	0.878	1.032E-26	296	0.327	0.328	P77938.pdb.gz	NADC_RHORU Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Rhodospirillum rubrum OX=1085 GN=nadC PE=3 SV=1
8	PDB:3c2vA	0.834	0.915	1.176E-26	270	0.424	0.467	3c2vA.pdb.gz	Comprehensive X-ray Structural Studies of the Quinolinate Phosphoribosyl Transferase (BNA6) from Saccharomyces cerevisiae.
9	AFDB:P30011	0.848	0.848	2.716E-26	297	0.313	0.313	P30011.pdb.gz	NADC_ECOLI Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Escherichia coli (strain K12) OX=83333 GN=nadC PE=1 SV=7
10	AFDB:A0A1S4CL59	0.857	0.728	1.338E-25	351	0.303	0.256	A0A1S4CL59.pdb.gz	QPT2B_TOBAC Quinolinate phosphoribosyltransferase [decarboxylating] 2b, mitochondrial OS=Nicotiana tabacum OX=4097 GN=QPT2b PE=1 SV=1
11	AFDB:Q9ZU32	0.843	0.723	8.758E-25	348	0.306	0.261	Q9ZU32.pdb.gz	NADC_ARATH Nicotinate-nucleotide pyrophosphorylase [carboxylating], chloroplastic OS=Arabidopsis thaliana OX=3702 GN=QPT PE=1 SV=2
12	PDB:1qpnA	0.851	0.888	1.119E-24	284	0.300	0.313	1qpnA.pdb.gz	Crystal structure of quinolinic acid phosphoribosyltransferase from Mycobacterium tuberculosis: a potential TB drug target.
13	AFDB:P9WJJ7	0.861	0.896	2.178E-24	285	0.296	0.309	P9WJJ7.pdb.gz	NADC_MYCTU Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nadC PE=1 SV=1
14	AFDB:P9WJI9	0.619	0.429	1.286E-12	448	0.236	0.156	P9WJI9.pdb.gz	PNCB1_MYCTU Nicotinate phosphoribosyltransferase pncB1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pncB1 PE=1 SV=1
15	PDB:4yubB	0.556	0.353	1.370E-7	501	0.236	0.140	4yubB.pdb.gz
16	PDB:4jnmB	0.525	0.355	1.231E-5	473	0.135	0.085	4jnmB.pdb.gz	Discovery of potent and efficacious urea-containing nicotinamide phosphoribosyltransferase (NAMPT) inhibitors with reduced CYP2C9 inhibition properties.
17	PDB:1vlpB	0.351	0.268	7.613E-5	419	0.118	0.084	1vlpB.pdb.gz
18	PDB:9rubA	0.214	0.152	4.448E-4	459	0.128	0.083	9rubA.pdb.gz	Crystal structure of activated ribulose-1,5-bisphosphate carboxylase complexed with its substrate, ribulose-1,5-bisphosphate.
19	PDB:4qccA	0.252	0.275	7.861E-4	270	0.121	0.133	4qccA.pdb.gz
20	PDB:1xbzB	0.308	0.411	1.312E-3	216	0.091	0.125	1xbzB.pdb.gz	Evolution of enzymatic activities in the orotidine 5'-monophosphate decarboxylase suprafamily: structural basis for catalytic promiscuity in wild-type and designed mutants of 3-keto-L-gulonate 6-phosphate decarboxylase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15274	0.0	595	297	1.000	1.000	NADC_HUMAN Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Homo sapiens OX=9606 GN=QPRT PE=1 SV=3
2	V9HWJ5	0.0	593	297	0.997	0.997	V9HWJ5_HUMAN Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Homo sapiens OX=9606 GN=HEL-S-90n PE=1 SV=1
3	I3LK75	4.27e-172	479	299	0.855	0.849	NADC_PIG Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Sus scrofa OX=9823 GN=QPRT PE=1 SV=2
4	Q5I0M2	5.03e-172	479	299	0.818	0.813	NADC_RAT Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Rattus norvegicus OX=10116 GN=Qprt PE=2 SV=1
5	P43619	8.87e-82	250	295	0.424	0.427	NADC_YEAST Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BNA6 PE=1 SV=1
6	P77938	2.40e-39	141	296	0.337	0.338	NADC_RHORU Probable nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Rhodospirillum rubrum OX=1085 GN=nadC PE=3 SV=1
7	B2RFS9	4.99e-39	142	351	0.293	0.248	QPT2_NICGL Quinolinate phosphoribosyltransferase [decarboxylating] 2, mitochondrial OS=Nicotiana glauca OX=4090 GN=QPT2 PE=1 SV=1
8	A0A1S4CL59	7.68e-39	141	351	0.296	0.251	QPT2B_TOBAC Quinolinate phosphoribosyltransferase [decarboxylating] 2b, mitochondrial OS=Nicotiana tabacum OX=4097 GN=QPT2b PE=1 SV=1
9	A0A1S4DFD3	1.14e-38	141	351	0.293	0.248	QPT2A_TOBAC Quinolinate phosphoribosyltransferase [decarboxylating] 2a, mitochondrial OS=Nicotiana tabacum OX=4097 GN=QPT2a PE=1 SV=1
10	Q9ZU32	1.39e-36	135	348	0.300	0.256	NADC_ARATH Nicotinate-nucleotide pyrophosphorylase [carboxylating], chloroplastic OS=Arabidopsis thaliana OX=3702 GN=QPT PE=1 SV=2
11	P30011	1.28e-35	131	297	0.310	0.310	NADC_ECOLI Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Escherichia coli (strain K12) OX=83333 GN=nadC PE=1 SV=7
12	P9WJJ7	3.09e-35	130	285	0.306	0.319	NADC_MYCTU Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=nadC PE=1 SV=1
13	Q6BF16	0.38	33.9	205	0.091	0.132	DGOA_ECOLI 2-dehydro-3-deoxy-6-phosphogalactonate aldolase OS=Escherichia coli (strain K12) OX=83333 GN=dgoA PE=1 SV=1
14	Q86WV6	1.3	32.7	379	0.165	0.129	STING_HUMAN Stimulator of interferon genes protein OS=Homo sapiens OX=9606 GN=STING1 PE=1 SV=1
15	A0A494C0W5	3.0	31.6	260	0.165	0.188	A0A494C0W5_HUMAN Stimulator of interferon genes protein OS=Homo sapiens OX=9606 GN=STING1 PE=1 SV=1
16	Q88N41	3.3	31.6	291	0.064	0.065	Q88N41_PSEPK Transcription regulatory protein (Pca regulon) OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=pcaR PE=4 SV=1
17	H0YCE5	3.6	29.3	70	0.047	0.200	H0YCE5_HUMAN Cyclin dependent kinase like 1 (Fragment) OS=Homo sapiens OX=9606 GN=CDKL1 PE=1 SV=1
18	Q6PBW9	3.9	31.2	228	0.037	0.048	Q6PBW9_DANRE Ribulose-phosphate 3-epimerase OS=Danio rerio OX=7955 GN=ik:tdsubc_2c8 PE=1 SV=1
19	Q389C2	6.0	30.4	246	0.074	0.089	Q389C2_TRYB2 Ribulose-phosphate 3-epimerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.1530 PE=3 SV=1
20	G5EDI2	6.6	31.2	3303	0.064	0.006	G5EDI2_CAEEL Reticulon-like protein OS=Caenorhabditis elegans OX=6239 GN=ret-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01729 QRPTase_C	1.1e-56	202.8	Quinolinate phosphoribosyl transferase, C-terminal domain
2	PF02749 QRPTase_N	5.1e-17	73.0	Quinolinate phosphoribosyl transferase, N-terminal domain
3	PF02581 TMP-TENI	66	14.3	Thiamine monophosphate synthase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378782

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401508	0.988	Nicotinate phosphoribosyltransferase
2	9606.ENSP00000366410	0.971	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1
3	9606.ENSP00000340523	0.966	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 3
4	9606.ENSP00000287713	0.962	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 2
5	9606.ENSP00000354387	0.956	Nicotinamide riboside kinase 1
6	9606.ENSP00000480091	0.939	Nicotinamide riboside kinase 2
7	9606.ENSP00000264932	0.918	Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
8	9606.ENSP00000230792	0.914	Peroxisomal NADH pyrophosphatase NUDT12
9	9606.ENSP00000339479	0.908	Cytosolic purine 5'-nucleotidase
10	9606.ENSP00000354238	0.908	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
11	9606.ENSP00000294973	0.904	3-hydroxyanthranilate 3,4-dioxygenase
12	9606.ENSP00000406261	0.904	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
13	9606.ENSP00000235628	0.900	Cytosolic 5'-nucleotidase 1A
14	9606.ENSP00000245552	0.900	5'(3')-deoxyribonucleotidase, cytosolic type
15	9606.ENSP00000352904	0.900	Cytosolic 5'-nucleotidase 1B
16	9606.ENSP00000373674	0.900	5'(3')-deoxyribonucleotidase, mitochondrial
17	9606.ENSP00000433415	0.900	NT5C1B-RDH14 readthrough
18	9606.ENSP00000264170	0.894	Kynureninase
19	9606.ENSP00000355517	0.858	Kynurenine 3-monooxygenase
20	9606.ENSP00000348459	0.820	2-amino-3-carboxymuconate-6-semialdehyde decarboxylase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0016763	0.999	pentosyltransferase activity
GO:0004514	0.985	nicotinate-nucleotide diphosphorylase (carboxylating) activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0019674	0.993	NAD metabolic process
GO:0043648	0.985	dicarboxylic acid metabolic process
GO:0090407	0.729	organophosphate biosynthetic process
GO:0019438	0.663	aromatic compound biosynthetic process
GO:0018130	0.663	heterocycle biosynthetic process
GO:1901362	0.647	organic cyclic compound biosynthetic process
GO:0009056	0.643	catabolic process
GO:0044271	0.627	cellular nitrogen compound biosynthetic process
GO:1901575	0.555	organic substance catabolic process
GO:0044248	0.544	cellular catabolic process
GO:0009165	0.531	nucleotide biosynthetic process
GO:0046700	0.490	heterocycle catabolic process
GO:0044270	0.489	cellular nitrogen compound catabolic process
GO:1901361	0.411	organic cyclic compound catabolic process
GO:0072525	0.371	pyridine-containing compound biosynthetic process
GO:0006164	0.357	purine nucleotide biosynthetic process
GO:1901565	0.345	organonitrogen compound catabolic process
GO:0019363	0.339	pyridine nucleotide biosynthetic process
GO:0009435	0.334	NAD biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0043231	0.960	intracellular membrane-bounded organelle
GO:0005829	0.947	cytosol
GO:0032991	0.875	protein-containing complex
GO:0005576	0.818	extracellular region
GO:0005634	0.759	nucleus
GO:0070013	0.674	intracellular organelle lumen
GO:1902494	0.660	catalytic complex
GO:0070062	0.610	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.2.-	0.999	Pentosyltransferases.
RHEA:12733	0.985	CO2 + diphosphate + nicotinate beta-D-ribonucleotide = 5-phospho-alpha-D-ribose 1-diphosphate + 2 H(+) + quinolinate
EC:2.4.2.19	0.985	nicotinate-nucleotide diphosphorylase (carboxylating).

[back to server]