StarFunc result for job id Q15287

User Input

>input (305 residues)
MDLSGVKKKSLLGVKENNKKSSTRAPSPTKRKDRSDEKSKDRSKDKGATKESSEKDRGRD
KTRKRRSASSGSSSTRSRSSSTSSSGSSTSTGSSSGSSSSSASSRSGSSSTSRSSSSSSS
SGSPSPSRRRHDNRRRSRSKSKPPKRDEKERKRRSPSPKPTKVHIGRLTRNVTKDHIMEI
FSTYGKIKMIDMPVERMHPHLSKGYAYVEFENPDEAEKALKHMDGGQIDGQEITATAVLA
PWPRPPPRRFSPPRRMLPPPPMWRRSPPRMRRRSRSPRRRSPVRRRSRSPGRRRHRSRSS
SNSSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3DU92	0.469	0.469	3.469E-42	305	1.000	1.000	D3DU92.pdb.gz	D3DU92_HUMAN RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=rnps1 PE=1 SV=1
2	AFDB:Q1MTR2	0.279	0.346	1.719E-12	243	0.203	0.255	Q1MTR2.pdb.gz	RNPS1_SCHPO RNA-binding protein with serine-rich domain 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13G1.14c PE=3 SV=2
3	AFDB:P62995	0.255	0.269	1.634E-10	288	0.269	0.285	P62995.pdb.gz	TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B PE=1 SV=1
4	AFDB:F4JAF3	0.274	0.233	1.747E-10	363	0.118	0.099	F4JAF3.pdb.gz	F4JAF3_ARATH Chloroplast RNA-binding protein 29 OS=Arabidopsis thaliana OX=3702 GN=CP29 PE=1 SV=1
5	AFDB:P19018	0.261	0.301	2.135E-10	264	0.230	0.265	P19018.pdb.gz	TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster OX=7227 GN=tra2 PE=1 SV=1
6	AFDB:P16914	0.263	0.169	1.489E-9	483	0.079	0.050	P16914.pdb.gz	ELAV_DROME Protein elav OS=Drosophila melanogaster OX=7227 GN=elav PE=2 SV=1
7	AFDB:Q8BP71	0.255	0.175	1.703E-9	449	0.151	0.102	Q8BP71.pdb.gz	RFOX2_MOUSE RNA binding protein fox-1 homolog 2 OS=Mus musculus OX=10090 GN=Rbfox2 PE=1 SV=2
8	AFDB:Q9ZUU4	0.259	0.273	1.703E-9	289	0.131	0.138	Q9ZUU4.pdb.gz	CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP29B PE=1 SV=1
9	AFDB:Q54Y98	0.258	0.242	2.226E-9	326	0.200	0.187	Q54Y98.pdb.gz	TRA2_DICDI Transformer-2 protein homolog OS=Dictyostelium discoideum OX=44689 GN=tra2 PE=3 SV=1
10	AFDB:A0A286YA75	0.253	0.208	2.721E-9	373	0.138	0.113	A0A286YA75.pdb.gz
11	PDB:6qx91K	0.245	0.369	1.287E-8	201	0.072	0.109	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
12	PDB:3lqvB	0.246	0.627	2.875E-8	115	0.066	0.174	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:7dvqY	0.253	0.543	2.875E-8	140	0.072	0.157	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:5yzg1	0.242	0.304	3.515E-8	243	0.062	0.078	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
15	PDB:6y53o	0.243	0.457	6.421E-8	160	0.069	0.131	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
16	PDB:5gm6V	0.253	0.588	9.597E-8	128	0.066	0.156	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:5xjcw	0.262	0.829	1.534E-7	91	0.079	0.264	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
18	PDB:1hl6A	0.255	0.630	2.144E-7	119	0.085	0.218	1hl6A.pdb.gz
19	PDB:6n7pA	0.246	0.398	2.144E-7	186	0.066	0.108	6n7pA.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
20	PDB:5oobB	0.259	0.507	3.204E-7	152	0.075	0.151	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3DU92	0.0	570	305	1.000	1.000	D3DU92_HUMAN RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=rnps1 PE=1 SV=1
2	H3BMM9	0.0	538	284	0.931	1.000	H3BMM9_HUMAN RNA-binding protein with serine-rich domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
3	H3BTC0	0.0	568	302	0.990	1.000	H3BTC0_HUMAN RNA-binding protein with serine-rich domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
4	Q15287	0.0	570	305	1.000	1.000	RNPS1_HUMAN RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
5	H3BUL0	1.34e-97	286	169	0.554	1.000	H3BUL0_HUMAN RNA binding protein with serine rich domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
6	H3BTY0	2.17e-83	249	150	0.492	1.000	H3BTY0_HUMAN RNA binding protein with serine rich domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
7	H3BUG0	1.57e-75	229	139	0.456	1.000	H3BUG0_HUMAN RNA binding protein with serine rich domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
8	H3BTR6	7.91e-67	206	127	0.416	1.000	H3BTR6_HUMAN RNA binding protein with serine rich domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
9	H3BNI3	1.48e-45	150	85	0.279	1.000	H3BNI3_HUMAN RNA binding protein with serine rich domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
10	H3BP82	2.50e-39	135	98	0.243	0.755	H3BP82_HUMAN RNA binding protein with serine rich domain 1 (Fragment) OS=Homo sapiens OX=9606 GN=RNPS1 PE=1 SV=1
11	Q9VHC0	1.22e-33	128	374	0.154	0.126	Q9VHC0_DROME LD23870p OS=Drosophila melanogaster OX=7227 GN=RnpS1 PE=1 SV=2
12	Q9SEE9	9.01e-16	79.3	414	0.105	0.077	SR45_ARATH Serine/arginine-rich splicing factor SR45 OS=Arabidopsis thaliana OX=3702 GN=SR45 PE=1 SV=1
13	Q1MTR2	1.16e-14	74.3	243	0.105	0.132	RNPS1_SCHPO RNA-binding protein with serine-rich domain 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC13G1.14c PE=3 SV=2
14	Q8I468	2.90e-09	59.3	308	0.154	0.153	Q8I468_PLAF7 Serine/arginine-rich splicing factor 12 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0503300 PE=4 SV=1
15	Q9FMG4	6.03e-09	58.5	303	0.082	0.083	SC35_ARATH Serine/arginine-rich splicing factor SC35 OS=Arabidopsis thaliana OX=3702 GN=SC35 PE=1 SV=1
16	Q5AB84	1.02e-08	58.2	400	0.092	0.070	Q5AB84_CANAL RRM domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C100160CA PE=4 SV=1
17	Q9DED4	2.28e-08	55.1	166	0.082	0.151	CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis OX=8355 GN=cirbp-b PE=1 SV=1
18	Q9FYB7	2.34e-08	56.6	284	0.092	0.099	RSZ32_ARATH Serine/arginine-rich splicing factor RS2Z32 OS=Arabidopsis thaliana OX=3702 GN=RS2Z32 PE=1 SV=1
19	P27476	3.41e-08	56.6	414	0.102	0.075	NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSR1 PE=1 SV=1
20	Q9VM49	3.52e-08	56.6	594	0.079	0.040	Q9VM49_DROME Caper, isoform A OS=Drosophila melanogaster OX=7227 GN=Caper PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09726 Macoilin	20	15.3	Macoilin family
2	PF14605 Nup35_RRM_2	14	17.0	Nup53/35/40-type RNA recognition motif
3	PF00076 RRM_1	1e-14	65.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF08777 RRM_3	12	17.4	RNA binding motif
5	PF13893 RRM_5	6.9	17.8	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF16367 RRM_7	2.4	19.7	RNA recognition motif
7	PF16842 RRM_occluded	40	15.5	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 225400.XP_006763957.1

Rank	PPI partner	STRING score	Description
1	225400.XP_006752700.1	0.999	Histone deacetylase complex subunit SAP18
2	225400.XP_006776845.1	0.996	Apoptotic chromatin condensation inducer in the nucleus isoform X1
3	225400.XP_006777589.1	0.974	Serine/arginine repetitive matrix protein 1-like isoform X1
4	225400.XP_006753109.1	0.963	Eukaryotic initiation factor 4A-III
5	225400.XP_006758002.1	0.963	Regulator of nonsense transcripts 3B-like isoform X1
6	225400.XP_006757792.1	0.940	Pinin
7	225400.XP_006753133.1	0.937	THO complex subunit 4
8	225400.XP_006767910.1	0.937	Uncharacterized protein LOC102775153
9	225400.XP_006778463.1	0.932	UPF1, RNA helicase and ATPase
10	225400.XP_006756275.1	0.930	Serine/arginine-rich splicing factor 1 isoform X1
11	225400.XP_006769378.1	0.916	Regulator of nonsense transcripts 3A
12	225400.XP_006753403.1	0.882	Regulator of nonsense transcripts 2-like isoform X1
13	225400.XP_006754412.1	0.876	Splicing factor U2AF 35 kDa subunit
14	225400.XP_006776543.1	0.869	Serine and arginine rich splicing factor 4
15	225400.XP_006754492.1	0.856	Serine/arginine-rich splicing factor 11 isoform X1
16	225400.XP_006775675.1	0.855	Interleukin enhancer-binding factor 2
17	225400.XP_006758009.1	0.851	Cleavage stimulation factor subunit 2 tau variant isoform X1
18	225400.XP_006769762.1	0.851	Cleavage stimulation factor subunit 2 isoform X1
19	225400.XP_006776222.1	0.849	Regulator of nonsense transcripts 2
20	225400.XP_006755006.1	0.839	Mitotic checkpoint protein BUB3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003729	0.787	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.995	regulation of metabolic process
GO:0016070	0.995	RNA metabolic process
GO:0010467	0.992	gene expression
GO:0048024	0.987	regulation of mRNA splicing, via spliceosome
GO:0006396	0.957	RNA processing
GO:0016071	0.956	mRNA metabolic process
GO:0010605	0.950	negative regulation of macromolecule metabolic process
GO:0008380	0.941	RNA splicing
GO:0048523	0.930	negative regulation of cellular process
GO:1903312	0.918	negative regulation of mRNA metabolic process
GO:0000381	0.895	regulation of alternative mRNA splicing, via spliceosome
GO:0033119	0.862	negative regulation of RNA splicing
GO:0048518	0.629	positive regulation of biological process
GO:0006397	0.505	mRNA processing
GO:0048522	0.462	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.927	protein-containing complex
GO:0005737	0.652	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]