StarFunc result for job id Q15303

User Input

>input (1308 residues)
MKPATGLWVWVSLLVAAGTVQPSDSQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSVREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNLTLVST
NGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIEAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
INQRIVIRDNRKAENCTAEGMVCNHLCSSDGCWGPGPDQCLSCRRFSRGRICIESCNLYD
GEFREFENGSICVECDPQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADPDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIVGLTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASMDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRARIDSNRSEIGHSPPPAYTPMSGNQFVYRDGGFAAEQGVSVP
YRAPTSTIPEAPVAQGATAEIFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFAPERS
PRGELDEEGYMTPMRDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHNASNGPPKAED
EYVNEPLYLNTFANTLGKAEYLKNNILSMPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTVLPPPPYRHRNTVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8S059	0.337	0.363	0.000	1210	0.618	0.668	A0A2R8S059.pdb.gz
2	AFDB:F1N7F3	0.414	0.456	0.000	1179	0.489	0.543	F1N7F3.pdb.gz	F1N7F3_BOVIN Receptor protein-tyrosine kinase OS=Bos taurus OX=9913 GN=EGFR PE=3 SV=3
3	AFDB:P00533	0.433	0.465	0.000	1210	0.491	0.531	P00533.pdb.gz	EGFR_HUMAN Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=2
4	AFDB:P21860	0.451	0.440	0.000	1342	0.472	0.461	P21860.pdb.gz	ERBB3_HUMAN Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens OX=9606 GN=ERBB3 PE=1 SV=1
5	AFDB:Q15303	1.000	1.000	0.000	1308	1.000	1.000	Q15303.pdb.gz	ERBB4_HUMAN Receptor tyrosine-protein kinase erbB-4 OS=Homo sapiens OX=9606 GN=ERBB4 PE=1 SV=1
6	PDB:7mn8B	0.227	0.498	3.337E-57	579	0.200	0.451	7mn8B.pdb.gz
7	AFDB:Q9ESE0	0.244	0.645	4.980E-47	478	0.158	0.433	Q9ESE0.pdb.gz	Q9ESE0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=2 SV=2
8	AFDB:A0A2R8RR02	0.206	0.245	1.890E-29	1101	0.112	0.133	A0A2R8RR02.pdb.gz	A0A2R8RR02_DANRE non-specific protein-tyrosine kinase OS=Danio rerio OX=7955 GN=fak PE=1 SV=1
9	AFDB:D3ZDH4	0.208	0.276	5.685E-29	977	0.094	0.126	D3ZDH4.pdb.gz	D3ZDH4_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Epha1 PE=1 SV=1
10	AFDB:P21709	0.211	0.280	3.207E-28	976	0.095	0.127	P21709.pdb.gz	EPHA1_HUMAN Ephrin type-A receptor 1 OS=Homo sapiens OX=9606 GN=EPHA1 PE=1 SV=4
11	AFDB:F7BN18	0.196	0.227	2.501E-25	1128	0.125	0.145	F7BN18.pdb.gz	F7BN18_XENTR Tyrosine-protein kinase OS=Xenopus tropicalis OX=8364 GN=abl1 PE=3 SV=4
12	PDB:4fl2A	0.191	0.439	1.524E-21	555	0.083	0.196	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.183	0.425	3.175E-21	551	0.076	0.181	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.186	0.544	6.971E-21	441	0.073	0.218	1k9aB.pdb.gz
15	PDB:6pxvA	0.158	0.242	2.884E-19	823	0.098	0.156	6pxvA.pdb.gz
16	PDB:2h8hA	0.187	0.532	3.203E-19	445	0.083	0.245	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
17	PDB:8dtlA	0.223	0.361	5.411E-19	741	0.102	0.179	8dtlA.pdb.gz
18	PDB:7bwaA	0.163	0.300	3.080E-16	674	0.116	0.226	7bwaA.pdb.gz
19	PDB:8eyyA	0.193	0.295	1.930E-15	775	0.089	0.150	8eyyA.pdb.gz
20	PDB:6pjxA	0.194	0.444	2.786E-15	543	0.050	0.122	6pjxA.pdb.gz	Structure of a GRK5-Calmodulin Complex Reveals Molecular Mechanism of GRK Activation and Substrate Targeting.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQB9	1134	1170	0.460	0.515	A0A8I5ZQB9_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=1 SV=1
2	A6QR62	1188	1336	0.443	0.434	A6QR62_BOVIN Receptor protein-tyrosine kinase OS=Bos taurus OX=9913 GN=ERBB3 PE=2 SV=1
3	B4DTR1	838	979	0.353	0.472	B4DTR1_HUMAN Erb-b2 receptor tyrosine kinase 2 OS=Homo sapiens OX=9606 GN=ERBB2 PE=1 SV=1
4	B8LFF6	1851	1414	0.693	0.641	B8LFF6_DANRE Receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=erbb4 PE=2 SV=1
5	E7CXR8	1229	1209	0.485	0.524	E7CXR8_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=2 SV=1
6	E7CXR9	1228	1209	0.483	0.523	E7CXR9_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=2 SV=1
7	F1N7F3	1189	1179	0.485	0.538	F1N7F3_BOVIN Receptor protein-tyrosine kinase OS=Bos taurus OX=9913 GN=EGFR PE=3 SV=3
8	G3V6K6	1221	1208	0.484	0.524	G3V6K6_RAT Receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Egfr PE=1 SV=2
9	J3QLU9	1073	1055	0.414	0.513	J3QLU9_HUMAN Receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=ERBB2 PE=1 SV=1
10	P00533	1215	1210	0.492	0.532	EGFR_HUMAN Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=2
11	P04626	1102	1255	0.459	0.478	ERBB2_HUMAN Receptor tyrosine-protein kinase erbB-2 OS=Homo sapiens OX=9606 GN=ERBB2 PE=1 SV=1
12	P06494	1075	1257	0.455	0.473	ERBB2_RAT Receptor tyrosine-protein kinase erbB-2 OS=Rattus norvegicus OX=10116 GN=Erbb2 PE=1 SV=3
13	P21860	1193	1342	0.444	0.433	ERBB3_HUMAN Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens OX=9606 GN=ERBB3 PE=1 SV=1
14	P70424	1078	1256	0.450	0.468	ERBB2_MOUSE Receptor tyrosine-protein kinase erbB-2 OS=Mus musculus OX=10090 GN=Erbb2 PE=1 SV=3
15	Q01279	1229	1210	0.490	0.530	EGFR_MOUSE Epidermal growth factor receptor OS=Mus musculus OX=10090 GN=Egfr PE=1 SV=1
16	Q15303	2735	1308	1.000	1.000	ERBB4_HUMAN Receptor tyrosine-protein kinase erbB-4 OS=Homo sapiens OX=9606 GN=ERBB4 PE=1 SV=1
17	Q153D9	2234	1299	0.810	0.815	Q153D9_XENLA Receptor protein-tyrosine kinase OS=Xenopus laevis OX=8355 GN=erbb4.L PE=2 SV=1
18	Q4PLA5	2461	1292	0.899	0.910	Q4PLA5_CHICK Receptor protein-tyrosine kinase OS=Gallus gallus OX=9031 GN=ERBB4 PE=2 SV=1
19	Q504U8	1125	1091	0.437	0.523	Q504U8_HUMAN Receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=1
20	Q5EBY4	1061	1275	0.453	0.465	Q5EBY4_DANRE Receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=wu:fv70f10 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	49	15.2	Phosphotransferase enzyme family
2	PF13131 DUF3951	1.2e+02	14.2	Protein of unknown function (DUF3951)
3	PF00757 Furin-like	6.6e-33	125.2	Furin-like cysteine rich region
4	PF14843 GF_recep_IV	4e-49	177.2	Growth factor receptor domain IV
5	PF12330 Haspin_kinase	39	14.6	Haspin like kinase domain
6	PF14531 Kinase-like	35	15.2	Kinase-like
7	PF00069 Pkinase	7.3e-36	135.5	Protein kinase domain
8	PF07714 PK_Tyr_Ser-Thr	2.3e-88	307.4	Protein tyrosine and serine/threonine kinase
9	PF01030 Recep_L_domain	8.1e-57	201.5	Receptor L domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342235

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230990	0.999	Proheparin-binding EGF-like growth factor
2	9606.ENSP00000341208	0.999	Signal transducer and activator of transcription 5A
3	9606.ENSP00000354910	0.999	Pro-neuregulin-2, membrane-bound isoform
4	9606.ENSP00000361214	0.999	Pro-neuregulin-3, membrane-bound isoform
5	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
6	9606.ENSP00000382428	0.999	Disks large homolog 4
7	9606.ENSP00000384620	0.999	Pro-neuregulin-1, membrane-bound isoform
8	9606.ENSP00000401303	0.999	SHC-transforming protein 1
9	9606.ENSP00000378367	0.998	Pro-neuregulin-4, membrane-bound isoform
10	9606.ENSP00000478927	0.998	Transcriptional coactivator YAP1
11	9606.ENSP00000379092	0.997	Probetacellulin
12	9606.ENSP00000457230	0.997	WW domain-containing oxidoreductase
13	9606.ENSP00000356426	0.996	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
14	9606.ENSP00000265171	0.995	Pro-epidermal growth factor
15	9606.ENSP00000293328	0.995	Signal transducer and activator of transcription 5B
16	9606.ENSP00000269571	0.987	Receptor tyrosine-protein kinase erbB-2
17	9606.ENSP00000480499	0.985	E3 ubiquitin-protein ligase Itchy homolog
18	9606.ENSP00000268712	0.984	Nuclear receptor corepressor 1
19	9606.ENSP00000244869	0.983	Proepiregulin
20	9606.ENSP00000405330	0.982	Estrogen receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004714	0.999	transmembrane receptor protein tyrosine kinase activity
GO:0005102	0.998	signaling receptor binding
GO:0042802	0.975	identical protein binding
GO:0019899	0.867	enzyme binding
GO:0097159	0.804	organic cyclic compound binding
GO:1901363	0.785	heterocyclic compound binding
GO:0003676	0.718	nucleic acid binding
GO:0003677	0.680	DNA binding
GO:0043565	0.666	sequence-specific DNA binding
GO:0003690	0.662	double-stranded DNA binding
GO:1990837	0.651	sequence-specific double-stranded DNA binding
GO:0098772	0.608	molecular function regulator activity
GO:0046983	0.608	protein dimerization activity
GO:0070851	0.598	growth factor receptor binding
GO:0000976	0.545	transcription cis-regulatory region binding
GO:0042803	0.519	protein homodimerization activity
GO:0005154	0.488	epidermal growth factor receptor binding
GO:0019900	0.350	kinase binding
GO:0038131	0.316	neuregulin receptor activity
GO:0044877	0.300	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0050896	0.988	response to stimulus
GO:0048522	0.978	positive regulation of cellular process
GO:0007165	0.972	signal transduction
GO:0048731	0.967	system development
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:0007169	0.948	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0080090	0.927	regulation of primary metabolic process
GO:0051171	0.917	regulation of nitrogen compound metabolic process
GO:0048519	0.908	negative regulation of biological process
GO:0007399	0.883	nervous system development
GO:0045937	0.869	positive regulation of phosphate metabolic process
GO:0010646	0.856	regulation of cell communication
GO:0009966	0.847	regulation of signal transduction
GO:0008284	0.832	positive regulation of cell population proliferation
GO:0048523	0.827	negative regulation of cellular process
GO:0048869	0.825	cellular developmental process
GO:0030154	0.823	cell differentiation
GO:0042325	0.814	regulation of phosphorylation
GO:0070848	0.791	response to growth factor
GO:0051130	0.781	positive regulation of cellular component organization
GO:0071495	0.779	cellular response to endogenous stimulus
GO:0051246	0.773	regulation of protein metabolic process
GO:0009967	0.770	positive regulation of signal transduction
GO:0038127	0.761	ERBB signaling pathway
GO:0065009	0.744	regulation of molecular function
GO:0010604	0.737	positive regulation of macromolecule metabolic process
GO:0031399	0.732	regulation of protein modification process
GO:0048513	0.731	animal organ development
GO:0071704	0.729	organic substance metabolic process
GO:0044238	0.721	primary metabolic process
GO:0044087	0.705	regulation of cellular component biogenesis
GO:0030879	0.687	mammary gland development
GO:0006807	0.683	nitrogen compound metabolic process
GO:0051173	0.679	positive regulation of nitrogen compound metabolic process
GO:0010468	0.674	regulation of gene expression
GO:1902531	0.672	regulation of intracellular signal transduction
GO:0043170	0.671	macromolecule metabolic process
GO:0051179	0.658	localization
GO:0031344	0.649	regulation of cell projection organization
GO:0065008	0.648	regulation of biological quality
GO:1902533	0.620	positive regulation of intracellular signal transduction
GO:0009889	0.612	regulation of biosynthetic process
GO:0051247	0.604	positive regulation of protein metabolic process
GO:0071840	0.603	cellular component organization or biogenesis
GO:0001932	0.603	regulation of protein phosphorylation
GO:0050790	0.597	regulation of catalytic activity
GO:0019219	0.594	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.587	regulation of cellular biosynthetic process
GO:0022008	0.578	neurogenesis
GO:0044237	0.571	cellular metabolic process
GO:0010556	0.570	regulation of macromolecule biosynthetic process
GO:0031401	0.568	positive regulation of protein modification process
GO:0016043	0.557	cellular component organization
GO:0010941	0.556	regulation of cell death
GO:1901564	0.544	organonitrogen compound metabolic process
GO:0019538	0.534	protein metabolic process
GO:0042327	0.534	positive regulation of phosphorylation
GO:0048699	0.520	generation of neurons
GO:0043067	0.508	regulation of programmed cell death
GO:0042221	0.492	response to chemical
GO:0001934	0.475	positive regulation of protein phosphorylation
GO:0009653	0.457	anatomical structure morphogenesis
GO:0051252	0.449	regulation of RNA metabolic process
GO:0060548	0.443	negative regulation of cell death
GO:0006355	0.440	regulation of DNA-templated transcription
GO:0036211	0.437	protein modification process
GO:0043085	0.428	positive regulation of catalytic activity
GO:0051239	0.424	regulation of multicellular organismal process
GO:0042981	0.398	regulation of apoptotic process
GO:0043549	0.395	regulation of kinase activity
GO:0120035	0.394	regulation of plasma membrane bounded cell projection organization
GO:0009891	0.370	positive regulation of biosynthetic process
GO:0009888	0.365	tissue development
GO:0032879	0.360	regulation of localization
GO:0031328	0.339	positive regulation of cellular biosynthetic process
GO:0010557	0.330	positive regulation of macromolecule biosynthetic process
GO:0045935	0.328	positive regulation of nucleobase-containing compound metabolic process
GO:0031346	0.324	positive regulation of cell projection organization
GO:0071363	0.321	cellular response to growth factor stimulus
GO:1902743	0.300	regulation of lamellipodium organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005886	1.000	plasma membrane
GO:0005622	0.997	intracellular anatomical structure
GO:0005737	0.989	cytoplasm
GO:0098590	0.982	plasma membrane region
GO:0043231	0.977	intracellular membrane-bounded organelle
GO:0005634	0.974	nucleus
GO:0030054	0.965	cell junction
GO:0032991	0.957	protein-containing complex
GO:0045202	0.769	synapse
GO:0005829	0.747	cytosol
GO:0012505	0.739	endomembrane system
GO:0098794	0.665	postsynapse
GO:0043233	0.648	organelle lumen
GO:0070013	0.637	intracellular organelle lumen
GO:0031982	0.595	vesicle
GO:0031981	0.567	nuclear lumen
GO:0005576	0.521	extracellular region
GO:0005654	0.492	nucleoplasm
GO:0016323	0.474	basolateral plasma membrane
GO:0043235	0.423	receptor complex
GO:0098857	0.387	membrane microdomain
GO:0045121	0.349	membrane raft
GO:0097708	0.348	intracellular vesicle
GO:0031410	0.341	cytoplasmic vesicle
GO:0005759	0.309	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	0.999	receptor protein-tyrosine kinase.

[back to server]