StarFunc result for job id Q15306

User Input

>input (451 residues)
MNLEGGGRGGEFGMSAVSCGNGKLRQWLIDQIDSGKYPGLVWENEEKSIFRIPWKHAGKQ
DYNREEDAALFKAWALFKGKFREGIDKPDPPTWKTRLRCALNKSNDFEELVERSQLDISD
PYKVYRIVPEGAKKGAKQLTLEDPQMSMSHPYTMTTPYPSLPAQQVHNYMMPPLDRSWRD
YVPDQPHPEIPYQCPMTFGPRGHHWQGPACENGCQVTGTFYACAPPESQAPGVPTEPSIR
SAEALAFSDCRLHICLYYREILVKELTTSSPEGCRISHGHTYDASNLDQVLFPYPEDNGQ
RKNIEKLLSHLERGVVLWMAPDGLYAKRLCQSRIYWDGPLALCNDRPNKLERDQTCKLFD
TQQFLSELQAFAHHGRSLPRFQVTLCFGEEFPDPQRQRKLITAHVEPLLARQLYYFAQQN
SGHFLRGYDLPEHISNPEDYHRSIRHSSIQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15306	1.000	1.000	3.773E-92	451	1.000	1.000	Q15306.pdb.gz	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
2	AFDB:A8B8L1	0.424	0.416	1.709E-60	460	0.630	0.617	A8B8L1.pdb.gz
3	AFDB:Q02556	0.569	0.600	8.262E-41	426	0.412	0.437	Q02556.pdb.gz	IRF8_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
4	AFDB:Q5NUI4	0.578	0.611	8.015E-40	424	0.408	0.434	Q5NUI4.pdb.gz
5	AFDB:Q6DHK7	0.507	0.535	5.593E-38	423	0.375	0.400	Q6DHK7.pdb.gz	Q6DHK7_DANRE Interferon regulatory factor 8 OS=Danio rerio OX=7955 GN=zgc:92252 PE=2 SV=1
6	AFDB:B5X4X0	0.384	0.401	4.272E-37	430	0.317	0.333	B5X4X0.pdb.gz	B5X4X0_SALSA Interferon regulatory factor 9 OS=Salmo salar OX=8030 GN=IRF9 PE=2 SV=1
7	AFDB:A0A0G2JUR2	0.379	0.361	4.810E-35	475	0.322	0.305	A0A0G2JUR2.pdb.gz	A0A0G2JUR2_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=2
8	AFDB:G0Z349	0.381	0.368	1.329E-34	467	0.306	0.296	G0Z349.pdb.gz	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
9	AFDB:Q13568	0.377	0.343	3.674E-34	498	0.322	0.291	Q13568.pdb.gz	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
10	AFDB:Q61179	0.357	0.400	1.960E-33	399	0.284	0.321	Q61179.pdb.gz	IRF9_MOUSE Interferon regulatory factor 9 OS=Mus musculus OX=10090 GN=Irf9 PE=1 SV=1
11	PDB:7dvqX	0.186	0.471	5.155E-2	156	0.024	0.071	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:5dudA	0.071	0.092	3.937E-1	300	0.022	0.033	5dudA.pdb.gz
13	PDB:4gojC	0.088	0.179	4.179E-1	161	0.038	0.106	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
14	PDB:3t6qC	0.077	0.167	4.710E-1	139	0.027	0.086	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:7a6hP	0.124	0.285	5.309E-1	146	0.042	0.130	7a6hP.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
16	PDB:7o0cA	0.111	0.171	5.636E-1	242	0.024	0.045	7o0cA.pdb.gz	Insight on molecular pathogenesis and pharmacochaperoning potential in phosphomannomutase 2 deficiency, provided by novel human phosphomannomutase 2 structures.
17	PDB:3b2dC	0.065	0.184	5.983E-1	139	0.031	0.101	3b2dC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
18	PDB:6djzB	0.067	0.120	5.983E-1	221	0.024	0.050	6djzB.pdb.gz	Structural basis for sigma1receptor ligand recognition.
19	PDB:4oicA	0.060	0.107	6.743E-1	182	0.029	0.071	4oicA.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
20	PDB:5z56X	0.180	0.438	6.743E-1	159	0.033	0.094	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15306	0.0	945	451	1.000	1.000	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
2	Q64287	0.0	882	450	0.922	0.924	IRF4_MOUSE Interferon regulatory factor 4 OS=Mus musculus OX=10090 GN=Irf4 PE=1 SV=1
3	Q02556	3.31e-98	303	426	0.408	0.432	IRF8_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2
4	P23611	6.75e-97	299	424	0.397	0.422	IRF8_MOUSE Interferon regulatory factor 8 OS=Mus musculus OX=10090 GN=Irf8 PE=1 SV=1
5	A0A8I6AJP7	7.95e-96	298	466	0.399	0.386	A0A8I6AJP7_RAT Interferon regulatory factor 8 OS=Rattus norvegicus OX=10116 GN=Irf8 PE=4 SV=1
6	Q6DHK7	9.96e-85	268	423	0.381	0.407	Q6DHK7_DANRE Interferon regulatory factor 8 OS=Danio rerio OX=7955 GN=zgc:92252 PE=2 SV=1
7	H3BT31	4.81e-84	263	328	0.348	0.479	H3BT31_HUMAN Interferon regulatory factor 8 (Fragment) OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=1
8	G0Z349	6.41e-64	215	467	0.324	0.313	G0Z349_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=4 SV=1
9	O14896	6.41e-64	215	467	0.324	0.313	IRF6_HUMAN Interferon regulatory factor 6 OS=Homo sapiens OX=9606 GN=IRF6 PE=1 SV=1
10	P97431	6.54e-64	215	467	0.317	0.306	IRF6_MOUSE Interferon regulatory factor 6 OS=Mus musculus OX=10090 GN=Irf6 PE=1 SV=2
11	P56477	8.69e-61	207	497	0.335	0.304	IRF5_MOUSE Interferon regulatory factor 5 OS=Mus musculus OX=10090 GN=Irf5 PE=1 SV=1
12	D3ZPU1	4.11e-57	198	497	0.335	0.304	D3ZPU1_RAT Interferon regulatory factor 5 OS=Rattus norvegicus OX=10116 GN=Irf5 PE=4 SV=1
13	B5X4X0	5.68e-45	164	430	0.157	0.165	B5X4X0_SALSA Interferon regulatory factor 9 OS=Salmo salar OX=8030 GN=IRF9 PE=2 SV=1
14	Q61179	5.32e-44	160	399	0.295	0.333	IRF9_MOUSE Interferon regulatory factor 9 OS=Mus musculus OX=10090 GN=Irf9 PE=1 SV=1
15	Q00978	1.31e-42	157	393	0.142	0.163	IRF9_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=1
16	H0YNP4	1.47e-42	157	402	0.142	0.159	H0YNP4_HUMAN Interferon regulatory factor 9 OS=Homo sapiens OX=9606 GN=IRF9 PE=1 SV=2
17	Q5XIB0	2.83e-38	145	421	0.275	0.295	Q5XIB0_RAT Interferon regulatory factor 3 OS=Rattus norvegicus OX=10116 GN=Irf3 PE=2 SV=1
18	F7EXX5	4.62e-38	146	466	0.275	0.266	F7EXX5_RAT Interferon regulatory factor 3 OS=Rattus norvegicus OX=10116 GN=Irf3 PE=1 SV=1
19	Q764M6	8.04e-37	141	419	0.271	0.291	IRF3_PIG Interferon regulatory factor 3 OS=Sus scrofa OX=9823 GN=IRF3 PE=1 SV=1
20	H3BRT4	1.31e-36	135	222	0.177	0.360	H3BRT4_HUMAN Interferon regulatory factor 8 OS=Homo sapiens OX=9606 GN=IRF8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00605 IRF	3.7e-39	144.5	Interferon regulatory factor transcription factor
2	PF10401 IRF-3	9.5e-62	219.5	Interferon-regulatory factor 3
3	PF03166 MH2	15	17.3	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370343

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227163	0.997	Transcription factor PU.1
2	9606.ENSP00000360266	0.997	Transcription factor AP-1
3	9606.ENSP00000264657	0.994	Signal transducer and activator of transcription 3
4	9606.ENSP00000286639	0.992	Basic leucine zipper transcriptional factor ATF-like
5	9606.ENSP00000384371	0.991	B-cell lymphoma 6 protein
6	9606.ENSP00000401399	0.991	Myeloid differentiation primary response protein MyD88
7	9606.ENSP00000365380	0.989	Forkhead box protein P3
8	9606.ENSP00000379330	0.986	Nuclear factor of activated T-cells, cytoplasmic 2
9	9606.ENSP00000389377	0.981	Nuclear factor of activated T-cells, cytoplasmic 1
10	9606.ENSP00000264867	0.974	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
11	9606.ENSP00000337383	0.968	NACHT, LRR and PYD domains-containing protein 3
12	9606.ENSP00000327048	0.962	Transcription factor Maf
13	9606.ENSP00000354394	0.960	Signal transducer and activator of transcription 1-alpha/beta
14	9606.ENSP00000300134	0.946	Signal transducer and activator of transcription 6
15	9606.ENSP00000369581	0.943	Interferon beta
16	9606.ENSP00000451828	0.940	RAC-alpha serine/threonine-protein kinase
17	9606.ENSP00000315768	0.939	Signal transducer and activator of transcription 2
18	9606.ENSP00000330341	0.938	Suppressor of cytokine signaling 3
19	9606.ENSP00000333657	0.938	Interferon-induced GTP-binding protein Mx2
20	9606.ENSP00000349960	0.938	Actin, cytoplasmic 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.997	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.989	cis-regulatory region sequence-specific DNA binding
GO:0001216	0.981	DNA-binding transcription activator activity
GO:0000978	0.970	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.966	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.992	cellular process
GO:0048519	0.991	negative regulation of biological process
GO:0051239	0.986	regulation of multicellular organismal process
GO:0048518	0.983	positive regulation of biological process
GO:0080090	0.982	regulation of primary metabolic process
GO:0010468	0.980	regulation of gene expression
GO:0051171	0.979	regulation of nitrogen compound metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0050896	0.973	response to stimulus
GO:0048856	0.968	anatomical structure development
GO:0048522	0.955	positive regulation of cellular process
GO:0009893	0.946	positive regulation of metabolic process
GO:0048523	0.943	negative regulation of cellular process
GO:0010604	0.943	positive regulation of macromolecule metabolic process
GO:0001817	0.918	regulation of cytokine production
GO:0031326	0.911	regulation of cellular biosynthetic process
GO:0010556	0.909	regulation of macromolecule biosynthetic process
GO:0051252	0.909	regulation of RNA metabolic process
GO:0045944	0.901	positive regulation of transcription by RNA polymerase II
GO:0051240	0.850	positive regulation of multicellular organismal process
GO:0030154	0.817	cell differentiation
GO:0048468	0.802	cell development
GO:0030097	0.785	hemopoiesis
GO:0002682	0.763	regulation of immune system process
GO:0009605	0.677	response to external stimulus
GO:0044419	0.672	biological process involved in interspecies interaction between organisms
GO:0010628	0.628	positive regulation of gene expression
GO:0051716	0.595	cellular response to stimulus
GO:0009607	0.581	response to biotic stimulus
GO:0051707	0.571	response to other organism
GO:0002376	0.530	immune system process
GO:0001819	0.509	positive regulation of cytokine production
GO:0008152	0.486	metabolic process
GO:0048583	0.476	regulation of response to stimulus
GO:0006950	0.470	response to stress
GO:0071704	0.431	organic substance metabolic process
GO:0044238	0.420	primary metabolic process
GO:0009892	0.400	negative regulation of metabolic process
GO:0032501	0.391	multicellular organismal process
GO:0006955	0.382	immune response
GO:0010605	0.358	negative regulation of macromolecule metabolic process
GO:0042221	0.357	response to chemical
GO:0006952	0.335	defense response
GO:0010646	0.331	regulation of cell communication
GO:0023051	0.330	regulation of signaling
GO:0048584	0.325	positive regulation of response to stimulus
GO:0006807	0.316	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005829	0.990	cytosol
GO:0016020	0.988	membrane
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0032991	0.758	protein-containing complex
GO:0071944	0.307	cell periphery
GO:0005694	0.302	chromosome
GO:0005886	0.301	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]