StarFunc result for job id Q15311

User Input

>input (655 residues)
MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDV
VSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKK
KEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQ
IDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKV
DELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKV
QEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQISNRVLYVF
FTHVQELFGNVVLKQVMKPLRWSNMATMPTLPETQAGIKEEIRRQEFLLNCLHRDLQGGI
KDLSKEERLWEVQRILTALKRKLREAKRQECETKIAQEIASLSKEDVSKEEMNENEEVIN
ILLAQENEILTEQEELLAMEQFLRRQIASEKEEIERLRAEIAEIQSRQQHGRSETEEYSS
ESESESEDEEELQIILEDLQRQNEELEIKNNHLNQAIHEEREAIIELRVQLRLLQMQRAK
AEQQAQEDEEPEWRGGAVQPPRDGVLEPKAAKEQPKAGKEPAKPSPSRDRKETSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15311	1.000	1.000	4.748E-80	655	1.000	1.000	Q15311.pdb.gz	RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3
2	AFDB:Q9PT60	0.540	0.540	1.683E-67	655	0.840	0.840	Q9PT60.pdb.gz	RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis OX=8355 GN=ralbp1-a PE=1 SV=3
3	AFDB:Q9VDG2	0.378	0.395	3.363E-25	625	0.293	0.307	Q9VDG2.pdb.gz	RLIP_DROME RalA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Rlip PE=1 SV=1
4	AFDB:Q1RLN5	0.264	0.217	1.486E-11	799	0.140	0.115	Q1RLN5.pdb.gz	Q1RLN5_HUMAN ARHGAP12 protein OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
5	PDB:6r3vA	0.261	0.829	6.759E-11	198	0.081	0.268	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
6	AFDB:O94466	0.272	0.257	8.652E-11	695	0.105	0.099	O94466.pdb.gz	RGA7_SCHPO Probable Rho-GTPase-activating protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga7 PE=1 SV=1
7	AFDB:X2JEI9	0.260	0.084	5.282E-10	2206	0.127	0.038	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
8	PDB:5jcpA	0.252	0.450	1.176E-9	361	0.061	0.111	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
9	PDB:3cxlA	0.262	0.420	1.357E-9	402	0.084	0.137	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
10	AFDB:O74360	0.244	0.173	1.112E-8	933	0.111	0.078	O74360.pdb.gz	RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga4 PE=1 SV=2
11	AFDB:Q7Z5H3	0.270	0.254	1.410E-8	698	0.084	0.079	Q7Z5H3.pdb.gz	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
12	PDB:5c2kA	0.246	0.413	2.146E-8	382	0.076	0.131	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
13	PDB:1xa6A	0.254	0.410	2.994E-8	399	0.075	0.123	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
14	AFDB:D4A9G6	0.262	0.133	4.637E-8	1310	0.093	0.047	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
15	AFDB:Q6REY9	0.266	0.150	5.100E-8	1182	0.072	0.040	Q6REY9.pdb.gz	RHG20_RAT Rho GTPase-activating protein 20 OS=Rattus norvegicus OX=10116 GN=Arhgap20 PE=1 SV=2
16	PDB:6xz4A	0.081	0.140	6.240E-1	304	0.064	0.138	6xz4A.pdb.gz
17	PDB:3hajA	0.065	0.141	9.132E-1	286	0.031	0.070	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
18	PDB:5xjt2	0.065	0.136	1.274	217	0.040	0.120	5xjt2.pdb.gz	Structures of 7S mutant complexes
19	PDB:6gn0A	0.069	0.137	1.696	239	0.038	0.105	6gn0A.pdb.gz
20	PDB:3axjA	0.075	0.191	1.956	225	0.032	0.093	3axjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15311	0.0	1329	655	1.000	1.000	RBP1_HUMAN RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3
2	Q62172	0.0	1011	648	0.918	0.927	RBP1_MOUSE RalA-binding protein 1 OS=Mus musculus OX=10090 GN=Ralbp1 PE=1 SV=4
3	Q62796	0.0	993	647	0.913	0.924	RBP1_RAT RalA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ralbp1 PE=1 SV=3
4	Q9DDA3	0.0	849	611	0.794	0.851	Q9DDA3_XENLA RalB-binding protein (Fragment) OS=Xenopus laevis OX=8355 GN=rlip1 PE=2 SV=1
5	Q9PT60	0.0	898	655	0.827	0.827	RBP1A_XENLA RalA-binding protein 1-A OS=Xenopus laevis OX=8355 GN=ralbp1-a PE=1 SV=3
6	Q9VDG2	2.32e-70	242	625	0.238	0.250	RLIP_DROME RalA-binding protein 1 OS=Drosophila melanogaster OX=7227 GN=Rlip PE=1 SV=1
7	Q10164	2.05e-25	114	1275	0.096	0.049	RGA2_SCHPO Probable Rho-type GTPase-activating protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rga2 PE=1 SV=1
8	Q7Z6I6	8.68e-25	112	1101	0.105	0.063	RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=3
9	F1LXF1	2.99e-24	110	1270	0.087	0.045	BCR_RAT Breakpoint cluster region protein OS=Rattus norvegicus OX=10116 GN=Bcr PE=1 SV=4
10	P11274	3.32e-24	110	1271	0.087	0.045	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
11	Q6PAJ1	3.44e-24	110	1270	0.087	0.045	BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus OX=10090 GN=Bcr PE=1 SV=3
12	A0A0A0MRJ9	3.51e-24	110	890	0.098	0.072	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
13	A0A0G2JTR4	6.18e-22	103	859	0.085	0.065	ABR_RAT Active breakpoint cluster region-related protein OS=Rattus norvegicus OX=10116 GN=Abr PE=1 SV=2
14	Q5SSL4	6.74e-22	103	859	0.085	0.065	ABR_MOUSE Active breakpoint cluster region-related protein OS=Mus musculus OX=10090 GN=Abr PE=1 SV=1
15	Q12979	1.04e-21	102	859	0.084	0.064	ABR_HUMAN Active breakpoint cluster region-related protein OS=Homo sapiens OX=9606 GN=ABR PE=1 SV=2
16	P34288	1.27e-21	102	1605	0.087	0.036	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
17	G5EF80	2.30e-21	101	966	0.093	0.063	G5EF80_CAEEL F-BAR domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spv-1 PE=1 SV=1
18	Q2M1Z3	2.44e-21	102	1444	0.089	0.040	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
19	E7F3F0	4.95e-20	97.8	2286	0.085	0.024	MY9AB_DANRE Unconventional myosin-IXAb OS=Danio rerio OX=7955 GN=myo9ab PE=3 SV=3
20	A6X8Z5	4.97e-20	97.8	1425	0.082	0.038	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17114 Nod1	8.4e+02	11.5	Gef2-related medial cortical node protein Nod1
2	PF00620 RhoGAP	1.8e-39	146.4	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000019317

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005257	0.999	Ras-related protein Ral-A
2	9606.ENSP00000272519	0.999	Ras-related protein Ral-B
3	9606.ENSP00000349824	0.984	RalBP1-associated Eps domain-containing protein 2
4	9606.ENSP00000392065	0.979	RalBP1-associated Eps domain-containing protein 1
5	9606.ENSP00000246792	0.969	Ras-related protein R-Ras
6	9606.ENSP00000383118	0.961	Cell division control protein 42 homolog
7	9606.ENSP00000348461	0.949	Ras-related C3 botulinum toxin substrate 1
8	9606.ENSP00000407586	0.940	GTPase HRas
9	9606.ENSP00000256078	0.928	GTPase KRas
10	9606.ENSP00000440005	0.927	ADP-ribosylation factor 1
11	9606.ENSP00000400175	0.924	Transforming protein RhoA
12	9606.ENSP00000292807	0.917	AP-2 complex subunit mu
13	9606.ENSP00000242285	0.900	Clathrin light chain A
14	9606.ENSP00000258739	0.900	ER lumen protein-retaining receptor 2
15	9606.ENSP00000298316	0.900	ADP-ribosylation factor 6
16	9606.ENSP00000309415	0.900	Clathrin light chain B
17	9606.ENSP00000329471	0.900	ER lumen protein-retaining receptor 1
18	9606.ENSP00000357048	0.900	Coatomer subunit alpha
19	9606.ENSP00000386918	0.900	ER lumen protein-retaining receptor 3
20	9606.ENSP00000249071	0.897	Ras-related C3 botulinum toxin substrate 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031267	0.999	small GTPase binding
GO:0005096	0.999	GTPase activator activity
GO:0042626	0.640	ATPase-coupled transmembrane transporter activity
GO:0042910	0.586	xenobiotic transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0009987	0.985	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0010646	0.970	regulation of cell communication
GO:0050896	0.968	response to stimulus
GO:0023051	0.944	regulation of signaling
GO:0051716	0.925	cellular response to stimulus
GO:0009966	0.903	regulation of signal transduction
GO:0035556	0.886	intracellular signal transduction
GO:1902531	0.870	regulation of intracellular signal transduction
GO:0007264	0.866	small GTPase mediated signal transduction
GO:0044093	0.861	positive regulation of molecular function
GO:0050790	0.738	regulation of catalytic activity
GO:0051179	0.729	localization
GO:0043087	0.710	regulation of GTPase activity
GO:0051234	0.651	establishment of localization
GO:0043085	0.641	positive regulation of catalytic activity
GO:0006810	0.627	transport
GO:0048518	0.613	positive regulation of biological process
GO:0048522	0.523	positive regulation of cellular process
GO:0051056	0.396	regulation of small GTPase mediated signal transduction
GO:0071840	0.325	cellular component organization or biogenesis
GO:0051345	0.312	positive regulation of hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0005886	0.997	plasma membrane
GO:0005737	0.996	cytoplasm
GO:0005829	0.992	cytosol
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0030054	0.898	cell junction
GO:0005739	0.884	mitochondrion
GO:0031982	0.569	vesicle
GO:0005654	0.337	nucleoplasm
GO:0045202	0.305	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.640	Translocases.

[back to server]